KEGG   Afipia carboxidovorans OM5 (Goettingen): OCA5_c16210
Entry
OCA5_c16210       CDS       T01617                                 
Symbol
trbE3
Name
(GenBank) conjugal transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
ocg  Afipia carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_c16210 (trbE3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_c16210 (trbE3)
Enzymes [BR:ocg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OCA5_c16210 (trbE3)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_c16210 (trbE3)
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 ABC_tran TrwB_AAD_bind AAA_29 AAA_10 ResIII TraG-D_C DUF87 FtsK_SpoIIIE AAA_23
Other DBs
NCBI-ProteinID: AEI06335
UniProt: B6JHP3
Position
1754308..1756812
AA seq 834 aa
MLNLAEYRKKSAQLADFLPWAALVAPGVVLNKDGSFQRTARFRGPDLDSATPAELVGTTA
RLNNALRRLGSGWAIFVEAQRHPATDYPESLFPDSASALLDIERREQFEDSGVLFESSYF
LTFAWLPPAEETSRMEAWLYEGREHGGVDPWELLKNFVDRTDRVLNLVEGFVPEADWLDD
AETLTYLHSTISTKRHQVRVPETPMHLDALLADQPLAGGLEPRLGDFHVRTLTIIGFPTT
TFPGILDDLNRLAFVYRWSTRAIMLDKTDATRLVTKIRRQWFAKRKSVAAILKEVMTNEQ
SVLLDTDAANKAADADAALQDLGSDQVGEVYVTATVTVWSADRAVADERLRLVEKVIQSH
DFTCIVEGVNAIEAWLGSIPGQTYANVRQPPISTLNLAHMMPLSAVWAGPARDEHLGAPP
LFYAKTEGATPFRFALHIGDVGHTMIVGPTGAGKSVLLALMALQFRRYHHSQVFVFDFGG
SIRAATLAMGGDWLDLGGSLTEDAESTSVSLQPLALIHHVPERAWAADWLVDILLREGVA
ITPEVKEYIWAALTSLASAPVEERTITGLTVLLQSSVLKQALRPYCIGGAHGRLLDAEHE
HLGTATVQAFETEGLIGTKAAPAVLSYLFHRIEARFDGRPSLLVIDEGWRALDDGGFADK
IKEWLKTLRKKNVSVVFSSQSLADIEASPIAPVLVESCPTRIFLANERAIEPQIMTVYER
FGLNARQIEIIARATPKRDYYCQSRRGNRLFELGLGAVALALCASSDKAAHALIDELLRD
GARPYFLEAWLYANDLAWAGDLVPNLTNVIDAIDASAATRQPPRITPSEQERPS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgctgaatctcgccgaataccggaaaaagagcgcgcagcttgcggactttctgccctgg
gccgcgctggttgcgccgggcgtcgtgctcaacaaggacggatcgtttcaacggacggcg
cgatttcggggtcccgatctcgacagcgcgacgccagccgagctggtcggtacgacagcg
cggcttaacaatgccttgcgccgtctcggctccggctgggcgatcttcgtcgaggcgcag
cgccatcccgccaccgactatccggaaagtctgtttccggactccgcatccgcgctcctc
gatatcgagcgccgcgagcagttcgaggactccggcgtcctgttcgagtcgagttacttc
ctcaccttcgcctggctgccgcctgccgaggaaacctcgcgcatggaagcctggctctat
gagggccgcgagcacggcggcgtcgatccgtgggaactgctgaaaaattttgtcgaccgg
accgaccgcgtgctcaacctggtcgaaggctttgtgccggaagccgactggctcgatgac
gccgagacgctgacctacctacattcgaccatctcgaccaagcggcatcaggtgcgcgtg
cccgagacgccgatgcacttggacgcgctgctggccgatcagccgcttgccggcgggctg
gaaccgcggcttggcgatttccatgtccgcacgctcaccatcatcggattcccgaccacg
acattccccggaattctcgacgacctcaaccggctcgccttcgtctatcgctggtcgacg
cgcgccatcatgctcgacaagacggatgcgacgcggctggtcacgaagattaggcggcaa
tggtttgccaagcgcaaaagcgttgccgcgatcctgaaagaggtgatgacgaacgagcag
tcggtgttgctggacactgacgcggccaacaaggccgccgatgccgacgcggccttgcag
gacctcggctccgatcaggtcggcgaagtctatgtcaccgcgaccgtcaccgtgtggagc
gccgatcgcgccgtcgccgacgaacgactgcggctggtcgaaaaggtcatccagtcgcac
gacttcacctgcatcgtcgaaggcgtcaatgccatcgaagcctggctcggctccatcccc
ggccagacctacgcgaacgtccgccaaccgccgatctcgacgcttaatttggcgcacatg
atgccgctctccgcggtctgggccgggccggcgcgggacgaacatcttggcgcgccgcca
ttattctacgccaagacagaaggggcgacccccttccgcttcgcgctgcatatcggcgac
gtcggccacaccatgatcgtgggaccgaccggggcggggaagtcggtgctactcgcgctg
atggcgctccagttccgacgctatcatcattcgcaggtgttcgtattcgactttggcggc
agcattcgcgctgcgacgctggcgatgggtggcgactggctggacctgggcggttcactc
accgaggacgcggaatccacctcagtttcgctccagccgctggcgctcatccatcacgtt
cccgaacgggcatgggccgccgactggctggtcgacattctcctgcgcgaaggcgtcgcc
atcacgccggaggtcaaggagtacatctgggccgcgctgacttcgctagcttcggcgccg
gtcgaggagcgcaccatcaccggcctgaccgtgctgttgcagtcctcggtgctaaagcag
gcgctgcggccatactgcatcggcggcgcacatggccgtctgctcgatgccgagcacgaa
catctcggcacggcgaccgtccaagccttcgagaccgagggacttatcggcaccaaggcc
gcgccagcggttctctcgtatctgttccaccgcatcgaagcccgcttcgacggacggccg
agcctactcgtcatcgacgaaggctggcgcgcgctcgatgacggcggtttcgccgacaag
atcaaggaatggctcaagacgctgcgaaaaaagaatgtcagcgtcgtgttctcctcgcag
tcgcttgccgacatcgaagcgtcgccgatcgcgcccgtgctggtcgagagttgcccgaca
cgcatcttcctcgccaacgaacgcgccatcgagcctcagatcatgaccgtctatgagcgg
ttcgggctcaatgcccggcagatcgaaatcatcgcgcgggcgaccccgaagcgcgactac
tactgccagtcacgacgcggcaaccggctgttcgagcttggtcttggcgctgtcgcactg
gcgctctgcgcatcgtcggacaaggccgcgcacgcgctgatcgacgagctactgcgcgac
ggcgcacggccgtacttcctcgaagcgtggctctacgccaacgacctcgcctgggccggc
gacctcgttcccaatctcaccaatgtcatcgatgcgatcgatgcgtccgccgcgacgcgt
cagccgccgcgcatcacgccgtcagaacaggagaggccatcatga

DBGET integrated database retrieval system