KEGG   Afipia carboxidovorans OM5 (Goettingen): OCA5_c16220
Entry
OCA5_c16220       CDS       T01617                                 
Name
(GenBank) putative conjugal transfer protein
  KO
K20266  type IV secretion system protein TrbJ
Organism
ocg  Afipia carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_c16220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_c16220
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_c16220
SSDB
Motif
Pfam: Effector_1 DUF4141 DUF948 DUF5065 PhoD_2 DUF5407 DUF5929 Sec34 Syntaxin_2
Other DBs
NCBI-ProteinID: AEI06336
UniProt: B6JHP2
Position
1756809..1757561
AA seq 250 aa
MILSVSRLSYPRSIAAGALALVVALAPGGAVAFDIVYDPSNYAQNVLTAARALQQINNQV
TSLANQTQMLINQAKQLTKLPTSVLSQIEGNFAEMKRLMGEADKLAYNVSNIEAQFSPTF
QNFAAGKSDAQLAALARDRWQQSLSAYEHSLKAGAVAVQNLEGTRSQTSTLLDTSQSAVG
LLQATQAGNQLLGVQARQVADLTAMLAAQGRADALENSRKAAAQEQSREQFSRFMIGSSY
SPTPVRMFHD
NT seq 753 nt   +upstreamnt  +downstreamnt
atgattctgtccgtatcccgcctgagttatccccgctcgatcgctgcgggagcgctcgcg
cttgtcgtggcgctcgcgcccggcggcgcggtcgcattcgacatcgtctacgacccgagt
aactacgcgcagaacgttctgactgccgcgcgcgcactgcaacagatcaacaatcaggtc
acttcgctcgccaatcagacgcagatgctcattaatcaagcgaagcagctaacgaagcta
ccgacgtcagttctctcgcagattgagggcaattttgccgaaatgaagcggctgatgggg
gaggctgataagctggcttacaacgtcagcaatatcgaggcgcagttctcgccgaccttc
cagaactttgcggccggcaagtccgacgctcaacttgccgctttggcacgcgatcgctgg
caacaatccttgtcggcctacgaacattcgctgaaggcgggcgctgtcgctgtgcagaac
ctcgagggcacgcgctcccagaccagcacgctgcttgacaccagccaatcggccgtcggc
ctgctccaggcgacgcaggccggcaaccagcttctcggcgttcaggcacggcaggttgcc
gatctcaccgcgatgctcgccgcacagggcagggccgacgctcttgaaaactcccgcaag
gccgcggcgcaagagcaatcgcgcgagcagttcagccgctttatgatcggaagcagctac
agccccacacccgttcgtatgtttcacgactga

DBGET integrated database retrieval system