KEGG   Afipia carboxidovorans OM5 (Goettingen): OCA5_c16230
Entry
OCA5_c16230       CDS       T01617                                 
Symbol
trbL3
Name
(GenBank) conjugal transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
ocg  Afipia carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_c16230 (trbL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_c16230 (trbL3)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_c16230 (trbL3)
SSDB
Motif
Pfam: TrbL Glyco_transf_7C
Other DBs
NCBI-ProteinID: AEI06337
UniProt: B6JHP1
Position
1757835..1759241
AA seq 468 aa
MNTGVIDRFLETFTRYIDSGFGLLGGEIGFLTSTLIVIDITLAGLFWAWGADEDVLARLV
KKTLYIGFFAFIIGNFNKLAGIVFQSFSGLGLKAGGSSMTADTLLQPGRVAQVGIDAGTP
ILKAAGDLMGYISFFENFVQIMVLMIAWAIVLIAFFILAVQIFVTLIEFKLTTLAGFVLI
PFALFNKTAFLAEKVLGNIVASGIKILVLAVIVGIGSGLFSEFTTGFSGTPTITDALALV
LGALSLMGLSIFGPGIATGLVSGAPQLGAGAAVGTGLAAAGIGAAGVMGATAGISGAASA
IGTGGRLSAASARGGAYLAGGVAQSYGQSASASGASGMRKAAAGVGGVAKAGAGAAVQPV
RQAVSRATQSLRSGADSLRSSYAAGRAAASNAAGGQASAGSAVAAGNTSTGGATGAGAAA
SSAPPNWAARMKRSQTMSHGATAAAHAVRSGDHGGGSMSVSLDQDDRK
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaacaccggcgtcatcgaccgctttctggagaccttcacccgctacatcgattcaggc
ttcggtctgctcggcggcgagatcggattcctcacctccacgctgatcgtcatcgacatc
acgctggccggcctattctgggcgtggggcgctgatgaagacgtacttgcgcgtctcgtc
aagaagacactttatatcggcttcttcgccttcatcatcggcaacttcaacaagctcgcc
ggcatcgtcttccagtccttcagcggcctcggcctgaaggccggcggatcgtcgatgacg
gccgacacgctgcttcaacccggccgtgtcgcgcaggtcggcatcgacgccggcactccc
atcctcaaggccgctggcgacctgatgggctacatctccttcttcgagaacttcgtgcag
atcatggtgctgatgatcgcctgggcgatcgtgctcatcgcctttttcatcctcgccgtc
cagatcttcgtcacgttgatcgagttcaagctcacgaccttagccgggttcgtcctgatc
cccttcgcgctgttcaacaagaccgcgttcctcgccgaaaaggtgcttggcaacatcgtt
gcctccggcatcaagatattggtgctcgccgtcatcgtcggcatcggctccggcctgttc
agtgagttcacgaccggattctccggcacgccgaccatcaccgacgcgctggcactcgtg
ctcggtgcgctgtcgctgatgggcctgtcgatcttcggtcccggtatcgccaccgggctc
gtctccggcgcaccgcaactcggtgcgggagccgccgttggcaccggccttgccgccgcc
ggcatcggcgcggctggcgtgatgggagcgacagcgggcatttccggcgcggcgagcgcg
atcggaaccggcggccgcttgtcggcggcaagcgcacgcggcggcgcatacctcgcgggc
ggcgtcgcccaatcctacgggcagtcggcttcggcctctggcgcatccggtatgaggaag
gcggctgccggcgtcggtggcgtggccaaggctggcgctggagcggctgttcaaccggtc
cggcaggcggtgtcgcgcgccacccaatcccttcggtcgggggcggattcccttcggtcg
agttatgcggcgggccgggccgccgcatcgaacgctgccggtggacaggcatctgcgggg
tcggcggtcgctgcgggcaatacctcaacgggcggggcgacaggtgcgggagcagcggct
tcgtcggcgccgcccaactgggccgcgcgcatgaaacgcagccagaccatgagccacggc
gcgaccgccgccgcccatgccgtgcgctctggcgatcacggcggcggctccatgtccgtt
tctctcgaccaggatgaccgcaaatga

DBGET integrated database retrieval system