KEGG   Afipia carboxidovorans OM5 (Goettingen): OCA5_c16240
Entry
OCA5_c16240       CDS       T01617                                 
Symbol
trbF3
Name
(GenBank) conjugal transfer protein TrbF
  KO
K20531  type IV secretion system protein TrbF
Organism
ocg  Afipia carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_c16240 (trbF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_c16240 (trbF3)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_c16240 (trbF3)
SSDB
Motif
Pfam: VirB8 Sensor
Other DBs
NCBI-ProteinID: AEI06338
UniProt: B6JHP0
Position
1759238..1759924
AA seq 228 aa
MNLFRRPSVRYARTPEPETPYLKAAQVWDERIGSARVQAKNWRMMAFGSLALAGGFAAAL
VWQSTLGTVVPWVVQVDKFGEAQVVASAIADYKPTDPQIAWHLARFIEQVRSIPADPVIV
RQNWLRAYDYTTDRGAIALNDYARGNDPFAKVGKQQVAVEISSVIRASPESFRIAWLERR
YENGQLSGTERWTAILSVVIQQPRTADKLRANPLGVFVNAINWSKEMG
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaatctcttccgccgaccttccgtccgctatgcgcgcacgcccgaacccgaaactccc
tatctcaaagccgcgcaggtgtgggatgagcgcatcggcagcgcgcgcgttcaggccaag
aattggcgtatgatggccttcggctcactggcgctcgccggcggcttcgcggccgcgctc
gtgtggcagtcgacgctgggcaccgtcgttccctgggtggtgcaggtcgacaagttcggc
gaggcgcaggttgtggcctccgccatcgcggactacaagccgaccgatccgcagatcgcg
tggcatctcgcgcgcttcatcgagcaggtgcgcagcattcccgccgatcccgtcatcgtg
cgacaaaactggctacgcgcctacgactacacgaccgatcgcggcgccatcgcgctcaac
gattacgcgcgcggcaacgatcccttcgcgaaggtcggtaagcagcaggtcgcggtcgag
atttccagcgtcatccgcgcatcacctgagagcttccggatcgcctggctagagcgccgc
tacgagaacggccagctctccggcacggaacgctggaccgccatcctgagcgtcgtgatc
cagcagccgcgcaccgccgacaagctgcgcgctaatccgctcggtgtgttcgtcaacgca
atcaactggtcgaaggagatggggtga

DBGET integrated database retrieval system