KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c23780Help
Entry
OCA5_c23780       CDS       T01617                                 

Gene name
folE2
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00790  Folate biosynthesis
ocg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCA5_c23780 (folE2)
Enzymes [BR:ocg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     OCA5_c23780 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEI07074
UniProt: B6JEN3
Position
complement(2558276..2558959)
Genome map
AA seq 227 aa AA seqDB search
MDAVIKPLRSKLDKTEVPAAEIDQAGVRPDQPRPTREEAESAVKTLLSYIGENPSREGLL
DTPRRMVEAYDELFQGYHQCPAEVLNRTFGETAGYDDFVLIRDIEFHSHCEHHVMPFYGK
AHIAYTPVDRVVGLSKIARLVDAFAHRLQTQEHLTAQIAAALDKVLQPRGVAVLLEAEHT
CMSVRGIAKHGAKTVTSRFTGMFYDNPDEQNRFLHMVRGISAPFAGA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgttatcaagccgctgcgcagcaagctcgacaagactgaagtccctgccgcc
gaaatcgatcaggccggcgtccgcccggaccagccgcgtcccacgcgcgaggaggccgag
agcgcggtcaagacgttgctgtcctatatcggcgagaacccctcccgcgagggcctgctc
gatacgccgcgccgcatggtcgaggcctatgacgagctgtttcaggggtatcaccagtgc
ccggccgaggtgctgaaccgcaccttcggcgagaccgcgggctatgacgatttcgtgctg
atccgcgatatcgaatttcactcgcattgcgagcatcacgtcatgccgttctacggcaag
gcgcacatcgcctatacgccggtggaccgcgtggtcggcctgtcgaagatcgcgcgtctc
gtcgatgcgttcgcgcatcgcctgcagacccaagagcatctcaccgcccagatcgccgcg
gcgctcgacaaggtgctgcagccgcgcggcgttgccgtgctgctcgaggccgagcatacc
tgcatgtcggtgcgcggcatcgccaagcacggcgccaagacggtgacgtcgcgctttacc
ggaatgttctatgacaatccggatgagcagaaccgttttctccatatggtgcggggcatt
agcgcgccatttgcaggcgcttga

DBGET integrated database retrieval system