KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c26420Help
Entry
OCA5_c26420       CDS       T01617                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase HldD
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00540  Lipopolysaccharide biosynthesis
ocg01100  Metabolic pathways
Module
ocg_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    OCA5_c26420 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ocg01005]
    OCA5_c26420 (hldD)
Enzymes [BR:ocg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     OCA5_c26420 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:ocg01005]
 Unusual sugar
  OCA5_c26420 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: AEI07337
UniProt: B6JBC5
Position
complement(2803793..2804773)
Genome map
AA seq 326 aa AA seqDB search
MFLVTGGAGFIGSNIVAALNEAGHADVVVSDFLGDEGKWRNLAKRQISDVVPPGELMAWL
RGRRLSGVIHMGAISATTATDGDLVFETNYRLSMRLLDWCTVNPTPFIYASSAATYGDGT
QGFRDDNSLEALKALRPMNLYGWSKYLFDVAVATRVAKNETLPPQWAGLKFFNVFGPNEY
HKGSMMSVLTRRFDDIKHGKTIQLFKSHREGIADGDQRRDFIYVDDVLRVVMWLVDNPRV
SGIFNVGTGKARSFRDLIVAVYAALGAKEKIAYIDMPEEIRGSYQYFTEADGEHLRRAGY
NGGFTPLEDSVASYVKNFLDRPDRYR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtttctggtgactggaggcgccgggtttatcggctccaatattgtcgcggcgctgaac
gaggccggccatgccgatgtcgtggtctcggatttcctcggcgacgagggcaagtggcgc
aacctcgccaagcggcaaatctccgacgtcgtgccgccgggcgaactgatggcatggctg
cgcgggcgcaggctctccggcgtcatccatatgggcgcgatctcggcgaccaccgcgacc
gatggcgacctcgtgttcgagaccaactatcgcctgtcgatgcggctcctcgactggtgc
accgtgaacccgacccccttcatctatgcctcgtcggcggcgacctatggcgacggcacg
cagggcttccgcgacgacaacagcctcgaggcgctgaaggcgttgcggccgatgaacctc
tacggctggagcaagtatctgttcgacgtcgcggtggcgacgcgcgttgcaaagaacgag
acgctgccgccgcaatgggcggggctgaagtttttcaacgtgttcgggcccaacgagtat
cacaagggttcgatgatgagcgtgctgacgcgccgcttcgacgacatcaagcacggcaag
accatccagcttttcaaatcgcatcgcgagggaattgccgacggcgaccagcgccgcgac
ttcatctatgtcgatgacgtgctgcgcgtggtgatgtggctcgtcgacaatccgcgcgtc
agcggcatcttcaatgtcggcaccggcaaggcgcgcagcttccgtgatctgatcgtcgcg
gtctatgcggcgctcggcgccaaggaaaagatcgcctatatcgacatgcccgaagaaatt
cgcggcagctaccagtatttcaccgaggcagacggcgagcatctgcgccgcgccggatat
aatggcggtttcacgccgctcgaggattcggttgcctcctacgtcaagaattttctcgat
cggccggaccgctatcgatga

DBGET integrated database retrieval system