KEGG   Afipia carboxidovorans OM5 (Goettingen): OCA5_pHCG301240
Entry
OCA5_pHCG301240   CDS       T01617                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
ocg  Afipia carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_pHCG301240 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_pHCG301240 (trbE)
Enzymes [BR:ocg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OCA5_pHCG301240 (trbE)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_pHCG301240 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 AAA_29 ABC_tran AAA_21 DUF87 AAA_23 AAA_16 FtsK_SpoIIIE ATPase_2 Zeta_toxin T2SSE
Other DBs
NCBI-ProteinID: AEI08195
UniProt: Q6LB36
Position
pHCG3:complement(128055..130493)
AA seq 812 aa
MVALRQFRHVDPSFTDLLPYAGLVAPGIILLKDGSLMAGWYFAGPDSESSTDVERNEVSR
LINAVLSRLGSGWMIQVEAVRVPARAYPARSDCHFPDAVTRAIDDERRRRFEAESGHFES
QHAMILTYRPPERRKSGLARYVYSDDESRSTSFADTTLAFFQTSIREVEQYLANVLSVRR
MQTQEVADEGSVRRARYDELFQFIRFSITGENHPIRLPEIPMYLDFLVTAEFHHGLSPVV
DDRYLAVVGIDGFPAESWPGILNGLDLMPLTYRWSSRFMFLDDQEARARLERTRKKWQQK
VRPFFDQLFQTQSRALDQDAMLMVAETEDAIGQASSGLVAYGYYTTVIVLFDTDERRLRD
KAEAVRRLVQAEGFGARIETLNATEAYLGSLPGNWYTNIREPLISTRNLADLIPLNAVWS
GSQTAPCPFYPPNSPPLMQVASGSTPFRMNLHVDDVGHTLVFGPTGSGKSTLLALIAAQF
RRYAGAQLFCFDKGRSMFPLTIAAGGDHYDVGGGEGLSFCPLAELKDDSDRAWAAEWIET
LVALQGVKITPDHRNAITHQIALMAAARGRSISDFVSGVQFREIKDALHPYTVDGPMGHL
LDAEQDGLLMSDFQTFEIETLMNMGERNLVPVLLYLFRRIEKRLTGAPSLIILDEAWLML
GHPTFRDKIREWLKVLRKANCAVLLATQSISDAERSGIIDVLKESCPTKICLPNGAARET
GTRDFYERIGFNERQIEIVATAIPKREYYVASPVGRRLFDMALGPITLSFVGATGKDDLT
RIAELRQQHGADWPARWLQARGVADADTLLSA
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggtggcgttgcgtcagtttagacatgtcgacccctccttcacggacctgcttccgtat
gcgggcctggtcgcaccggggatcattctattgaaagacggctcgctcatggcgggctgg
tattttgcggggcctgacagcgaaagctccaccgacgtcgagcgcaacgaggtgtctcgt
ttgatcaatgccgttctgtcacggctaggttccggctggatgatccaggtggaggccgtg
cgtgtgccggcgcgagcctatcccgcgcgatcagactgccattttccggacgccgtgacc
cgcgcgatcgatgatgaacggcgccgacgcttcgaagcggaaagcgggcatttcgaatct
cagcacgcgatgatcctgacctaccgaccacccgaacgccgcaagtccggcctcgcacgc
tatgtgtattccgacgacgaaagtcgatcgacatcgtttgccgacaccacactcgctttc
tttcagacctcgatccgcgaggttgagcaatatctcgccaacgtactctcggttcgccgc
atgcagacacaggaggtcgcggacgaggggagcgtgcgccgcgcacgctacgatgagctc
ttccaattcatccgcttcagcatcaccggcgaaaatcatccgatccggttgcctgagatt
ccgatgtatctggattttctcgtgaccgccgagttccaccatggactgtcgcctgtcgtg
gatgatcgctatctggcggtcgtaggcatcgacggattccccgcggagagctggcccggc
atcctcaatggtctcgacctcatgccgctgacctatcgctggtcgagccgcttcatgttt
ctcgacgaccaggaggcacgggctcgcctcgagcgtacacggaagaaatggcagcagaag
gtacggcccttcttcgatcagcttttccaaacccaaagccgtgcgctcgatcaggacgcc
atgttgatggtggccgaaacggaggatgcgatcggtcaagcctcctctggtctcgttgcc
tacggatactacacgactgtgatcgtgctgttcgacacagacgaacgccgtctccgtgat
aaagcggaagccgtccgtcggctcgtccaggcggaaggctttggagcacgcattgagacc
ttgaacgcaaccgaggcctatctcggctcgttgccgggaaactggtacacgaacatccgc
gaaccgctcatcagcacccgcaatctcgccgacctcatccctcttaatgcggtgtggtcc
ggcagccaaaccgcaccctgtccgttctatccgccgaactcgccgccgctgatgcaggtc
gcctccggatcgacccctttccggatgaatctccacgtcgacgacgtcggtcacacactg
gtgttcggcccgacaggctccggcaagtcgactttgcttgcactcatcgcggcgcagttt
cgacgttacgctggcgctcagctcttttgtttcgacaagggccgttcgatgtttccgctg
acgatcgccgccggcggagatcactacgacgtgggcggaggcgaaggtctgtctttctgt
ccactcgccgaactcaaggacgactccgatcgcgcctgggcggccgaatggatcgagacg
ctggtggcgctgcagggcgtcaagattacgccggatcatcgcaacgcgatcacgcatcag
atcgccttaatggcagcggcgcgcggacgctcgatctctgattttgtatcgggcgtgcag
tttcgcgagataaaggacgcgcttcacccctacacggtcgatggcccgatgggccacctg
ctcgatgcagagcaggacggcctgttgatgtccgattttcaaacgttcgagattgaaacg
ctcatgaacatgggcgaacggaatcttgtaccagtgttgctgtatctgttccgccgcatc
gagaagcggctgaccggcgcacccagcctcattatccttgacgaggcgtggctgatgctc
ggacacccgaccttccgcgacaagatccgcgaatggctcaaggtgctgcgcaaagccaat
tgcgcagtgctgctcgccactcaatcgatctctgacgccgagcgttcgggaatcatcgac
gtgctcaaggaatcgtgtccgacgaagatctgcctgccgaacggcgcagcccgcgagact
ggcacgcgcgatttctacgagcgcatcggtttcaatgaacgccagatcgaaattgtcgcg
accgcaataccgaagcgtgagtactacgtagcctcacccgtcggccggcggcttttcgat
atggccttggggccgatcacgctgtcgtttgttggcgcgacgggcaaggacgacctcact
cggatcgccgagctgcgtcagcagcatggcgcggactggcccgcacgatggcttcaagca
aggggagtggccgatgccgacacgcttctttccgcgtag

DBGET integrated database retrieval system