KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_pOC16701150Help
Entry
OCA5_pOC16701150  CDS       T01617                                 

Gene name
virB8
Definition
(GenBank) type IV secretion protein VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    OCA5_pOC16701150 (virB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_pOC16701150 (virB8)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   OCA5_pOC16701150 (virB8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 T7SS_ESX1_EccB
Motif
Other DBs
NCBI-ProteinID: AEI08311
UniProt: B6JK49
Position
pOC167:complement(112216..112932)
Genome map
AA seq 238 aa AA seqDB search
MTETVTSEPARVDPRYYADGATWERDIARRNRNSRALAWIVATVMSVVAVGALGTLALLV
PLKTYEPYMVVVDKTTGFVEVKRPMAEGPLTQDEAVTTFNVVRYIKARETYDPKALKDNF
DLAQLLATGDAARELTEIYSPANPNNPVKVYGTNTVVAVTIKSVTFPNNRTALARFSTEE
KSSTNVITRNWVSLVRFRYTSAPMRNEWRFDNPLGFQVLEYRRDQETAPSPGTVGAQQ
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaccgtgacatcagagcccgcgcgcgtcgatccgcgctactatgccgacggc
gcgacatgggagcgcgacatcgcgcggcggaatcgcaactcccgcgcgctggcctggatc
gtcgcgaccgtgatgagcgtggtcgcagtcggggcgctcggaacactcgccctgctcgtc
ccgctcaagacctacgagccttatatggtcgttgtcgacaagacgaccggcttcgtcgag
gtgaagcgcccgatggccgaaggcccgttgacccaggacgaagcggtgacgacgttcaac
gtcgtccgttacatcaaggcgcgggaaacttatgaccccaaggcgttgaaggacaacttc
gacctcgcccagctgctggcgacgggagacgcagcgcgtgagctcacggaaatctactcg
cccgccaatccgaacaatcccgtcaaggtctacggcaccaacactgttgtcgcggtcaca
atcaaatccgtgaccttcccgaacaatcgaaccgcgctggcgcggttttcgaccgaggag
aaatcatcgaccaacgtcattacgcgcaactgggtctcgctcgtgcggttccgctatacc
tccgcgccgatgcgcaatgagtggcgcttcgacaatccgctcggcttccaggtgctggaa
tatcgccgcgatcaggaaacggcgccgtcgcccggaactgtgggtgcgcaacaatga

DBGET integrated database retrieval system