KEGG   Ochrobactrum sp. A44: CES85_0023Help
Entry
CES85_0023        CDS       T05040                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
och  Ochrobactrum sp. A44
Pathway
och00625  Chloroalkane and chloroalkene degradation
och00680  Methane metabolism
och01100  Metabolic pathways
och01120  Microbial metabolism in diverse environments
och01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CES85_0023 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CES85_0023 (fdhA)
Enzymes [BR:och01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     CES85_0023 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ASV85353
UniProt: A0A248UEV3
Position
1:complement(24501..25670)
Genome map
AA seq 389 aa AA seqDB search
MYMRPGKVEVRDIDDPVLSAPDGRKLDHAVILKVITTNICGSDQHMVRGRTTAMPGLVLG
HEITGEVIEKGSDVEMLEVGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPSRAGGAYGYV
DMGGWIGGQARYVMVPYADFNLLKFPDREQAIEKIRDLTMLSDILPTGFHGAVKAGVGVG
SIVYVAGAGPVGLAAAASARILGAAVVMVGDFNKERLEHARKVGFEPIDLSASDRLGDMI
AEVTGSNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRPAGSIGIPGLYVTEDPGAV
DKAAQQGSLSLRFGLGWAKAQSFHTGQTPVVKYNRQLMQAILHGRLNIAEIVNAQVISLD
DAPQGYESFDQGVAKKFVLDPHGMLTKAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatgcgcccgggtaaagtcgaagttcgtgacattgatgatccggtattgagcgca
cctgatggtcgcaaacttgatcacgccgtcatcctgaaagtcatcacaaccaatatttgc
ggctccgaccaacacatggtgcgtggtcgtaccactgccatgcccggccttgtgctcggt
cacgaaatcacaggcgaagtgattgaaaaaggcagcgatgtcgaaatgcttgaagtgggc
gacatcgtttcggtaccgtttaacgtcgcctgtgggcgctgccgctgctgcaaatcgcag
gacacaggtgtctgcctcacagtcaacccctcgcgcgccggtggcgcttatggctatgtc
gatatgggcggctggattggcgggcaagcgcgctatgtcatggtgccttatgcagacttc
aacctgctgaaatttccagatcgtgaacaggccatcgagaaaattcgcgacctgaccatg
ctttccgacattctgcccaccggcttccatggtgcggtgaaggctggcgttggggtaggc
tcgatcgtctatgtggcaggtgccggtcctgttgggcttgctgcagcagcatccgcccgc
atcctgggcgctgcagtcgtcatggttggagacttcaataaggaacgtcttgagcacgca
cggaaagtgggcttcgagccgattgatctgtccgccagcgatcgcctcggcgatatgatt
gccgaagtaaccggcagcaatgaagtggatagcgccattgatgcggtaggctttgaagca
cgtggtcacagtggcggtgagcagccggcaatcgtgctcaaccagatgatggaaatcacg
cgccctgccggttccatcggcattccaggtctttatgtgacggaagatccgggtgctgtc
gacaaggcagcccagcagggaagtctttccttacgctttggtcttggctgggcaaaggcg
cagtctttccatacaggacagacgccagtggttaaatataatcgccaactgatgcaggcc
attttgcacggacgtctgaacattgccgaaatcgtcaatgcgcaggtgatttcgttggat
gacgcaccacaaggctatgaaagcttcgatcagggcgtggcgaagaaattcgtcctcgac
ccgcacgggatgctgacaaaggccgcttaa

DBGET integrated database retrieval system