KEGG   Ochrobactrum sp. A44: CES85_1749Help
Entry
CES85_1749        CDS       T05040                                 

Definition
(GenBank) transcriptional regulatory, C terminal family protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
och  Ochrobactrum sp. A44
Pathway
och02020  Two-component system
Brite
KEGG Orthology (KO) [BR:och00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CES85_1749
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:och02022]
    CES85_1749
Two-component system [BR:och02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CES85_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ASV85216
UniProt: A0A248UEX5
Position
1:1642332..1643036
Genome map
AA seq 234 aa AA seqDB search
MAVDENNLSDDAPHLLVVDDDTRIRSLLSQYLTTSGFRVTMAGSAAEARRKLEGIDFDLL
ILDVMMPGETGVSLTRSLREQKSVPILMLTALSETDSRIDGLSAGADDYLPKPFDPRELI
LRINNILRRGASPSQLKIEQIVFGPYTFFIPRRELKKGTETIKLTDREQDIMAIFAERAG
ETIPRHELTGQDGDVGERTIDVQINRLRRKIEQDPANPVWLQTVRGIGYKLSIE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagatgaaaacaacctttccgacgacgcgccacatcttcttgttgtcgatgat
gacacgcgaattcgcagcctgctttcgcaatatctgacgactagcggttttcgagtgacc
atggctggcagcgcagcagaagcgcgccgcaagctcgaaggcatcgatttcgacctgcta
atcctcgacgtgatgatgcccggcgaaaccggtgtctcgctgacccgttcactgcgtgag
cagaaaagcgtgccgatcctgatgctgaccgctttgtcagaaaccgacagcaggatcgat
ggtctgtcagcaggcgcagatgactatctgccaaagccttttgatccacgcgaactgatc
ttgcgtatcaacaatatcctccgccgtggtgcgtcaccgtcccagctgaaaatcgaacag
atcgtttttggaccttacaccttcttcattccgcgtcgcgaattgaagaagggcaccgag
acaatcaagctcacggatcgcgagcaggatatcatggcgattttcgccgagcgtgccggt
gaaaccattccgcgtcatgaactgaccggacaggacggcgatgtcggcgaacgcacaatt
gatgtgcagatcaaccgcctgcgtcgcaagatcgagcaggacccggctaatcccgtctgg
ctgcaaaccgttcgcggcatcggctataagctgagcatcgagtag

DBGET integrated database retrieval system