KEGG   Ochrobactrum sp. A44: CES85_2891Help
Entry
CES85_2891        CDS       T05040                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
och  Ochrobactrum sp. A44
Pathway
och00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CES85_2891
Enzymes [BR:och01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CES85_2891
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CES85_2891
    1.1.1.-  
     CES85_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Methyltransf_25 AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ASV87934
UniProt: A0A248UMQ4
Position
unnamed1:complement(146161..147240)
Genome map
AA seq 359 aa AA seqDB search
MRALRFYAAKDLRVENVSAPAGSDIEPDQVLIENCFCGICGTDLHEYAYGPIFIPTEPHP
FTKAGAPQILGHEFGGVVKAVGSDVTHVTIGDRVSVQPLIMPRAGDYFADRGLYHLSTSL
ALAGLSWHSGGMAEMALLNAYNVQPIPDDLSYEEAALIEPTAVAVYACDRGGVTAGNSVL
VTGAGPIGILTAMAARAAGASQIFLSDLNDTRLQLAREKLGDVRTINPKSENVGEVVRAE
TEGNVGCDVAIECVGNEHALKNCTDAVRKQGVVVQTGLHPHENPLNWFDVTFKDIDIRGS
WAYPTHYWPRVARLIASGQIPASKIVTKTIALEDAVVEGFDRLLDPAGTQLKILIDLKR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctttgcgcttttatgctgccaaggatctgcgtgttgaaaacgtgtcggcgcca
gccggttccgatatcgagcctgatcaggtgctgatcgaaaattgcttctgtgggatatgt
gggaccgatttgcacgaatatgcttatggcccgatttttattccaaccgaaccacatcca
ttcaccaaggcgggtgccccgcaaattctgggacatgaatttggcggcgtggtcaaagcc
gtgggaagtgatgtaacgcacgtaacaattggcgaccgtgtatcagtacagccgctcatc
atgcctcgcgcgggcgactattttgctgatcgtggcctctatcacctgagtaccagtctg
gcattggcgggcctttcctggcactcgggcggtatggctgaaatggctttgttgaacgct
tataatgttcagccaatccctgacgatcttagttacgaagaagcagcgctcattgagcca
accgcagtggcggtatatgcctgtgatcggggcggcgttacggctggtaacagcgtcctt
gtcactggtgctgggccaattggcattttgacagcaatggcagcacgcgccgcaggtgcg
tcacaaatattcctctccgatctaaacgacacacgtttgcagctggcacgtgaaaagctt
ggtgatgttcgcaccattaatccgaaatcagaaaatgtaggtgaggtagttcgcgcggaa
accgaaggtaatgttggttgtgacgttgctattgagtgcgtcggcaatgagcacgcattg
aagaattgcactgatgccgtccgaaaacaaggcgttgtggtacagacgggcttgcacccc
catgagaacccactcaactggttcgatgttacattcaaggacatcgatattcgaggctcg
tgggcatatcccacccattattggccgcgtgtagctcggctgattgcaagcggtcagata
ccagcaagcaagatcgtgaccaaaacaatcgcgttggaggatgcagttgttgaaggcttt
gacaggttgcttgatccagcgggtacccagctgaaaatcctgatcgatctgaaaagataa

DBGET integrated database retrieval system