KEGG   Ochrobactrum sp. A44: CES85_3441Help
Entry
CES85_3441        CDS       T05040                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
och  Ochrobactrum sp. A44
Pathway
och00310  Lysine degradation
och01100  Metabolic pathways
och01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CES85_3441
Enzymes [BR:och01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     CES85_3441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ASV87785
UniProt: A0A248UM15
Position
unnamed1:complement(661765..662955)
Genome map
AA seq 396 aa AA seqDB search
MYDYCLVGGGIIGLATALTIVRQEPSARILMLEKEEAVAMHQTGHNSGVIHAGIYYQPGS
FKAELCRAGERMTKQFCDENNIAYRVPGKLVVATNEVEVQRLAALETNAAANGIPCRRLN
GGELHEFEPAVTGLGALLVEQSGIVDYRAVCRAMADLIRAAGGHIEFNVCVESIEERSDS
VRVHAGGKVWESRQVIACAGLQADRLARRSGVDVDFQIVPFRGEYYALRPELNKIVERMI
YPVPDPSMPFLGIHLTPMIDGSLTVGPNAVLGLSREGYPKFSANLRDMASYAAFPGFWKV
ITAHLSSGLEEMKDSLFKKSYLEKCRKYCPSLQESDLRPYQAGIRAQAVSRDGKLIHDFK
FHQTKRVLHVCNAPSPAATSAIPIGNLIFQRLQTGN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattattgtctggttggcggcggcattattggccttgccacggcccttaccatt
gtccggcaggaaccttcagcccgcattctgatgctggagaaggaagaagccgttgcgatg
catcagaccggccataatagcggtgtgattcatgctggcatctattaccagcccggcagc
ttcaaggcagagctttgccgcgctggcgagcgcatgacgaagcagttctgtgacgagaac
aacattgcctatcgagttcccggaaagcttgttgttgcgacaaacgaagtcgaagtacag
cgcctcgccgcccttgaaacgaatgcggctgcgaacggcattccctgtcgtcgtctcaac
ggcggtgaattgcacgaattcgaacccgctgtgaccgggcttggtgccttgcttgtcgag
cagagcggcattgtcgattatcgtgcggtctgccgcgcgatggccgatctcattcgggct
gctggtggccatatcgagttcaatgtgtgtgtagagagcattgaagaacgcagcgacagt
gtgcgagtccatgcgggcggcaaggtatgggaaagcaggcaggtcatcgcctgcgcggga
ctgcaggctgaccgccttgcccgccgatccggtgtcgatgtcgacttccagatcgtgccg
tttcgcggcgaatattatgcgttgcggcctgaactgaacaaaattgtcgaacgcatgatt
tatccggtgccggacccttcgatgccgtttctcggcattcatctgacgccgatgatcgac
ggcagcttgaccgtcggacccaatgccgttctgggcttgtcgcgcgaaggctatccaaaa
ttctcggccaatttgcgtgatatggcgtcctatgcagcctttccgggcttctggaaagtg
atcaccgcccatctttcgtccggcctggaagagatgaaggatagcttgttcaagaagagc
tatctggaaaagtgccggaagtattgcccatccctgcaagaaagcgaccttcggccctat
caggcgggaataagagcacaggccgtttcgagagacggcaagcttattcacgacttcaag
ttccaccagacgaaacgtgtgctgcatgtgtgcaatgcaccctcgcccgcagccacgtcg
gccatacctatcggaaatctgatctttcaacgcttgcaaacaggtaattga

DBGET integrated database retrieval system