KEGG   Ochrobactrum sp. A44: CES85_5003Help
Entry
CES85_5003        CDS       T05040                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
och  Ochrobactrum sp. A44
Pathway
och00010  Glycolysis / Gluconeogenesis
och00053  Ascorbate and aldarate metabolism
och00071  Fatty acid degradation
och00280  Valine, leucine and isoleucine degradation
och00310  Lysine degradation
och00330  Arginine and proline metabolism
och00340  Histidine metabolism
och00380  Tryptophan metabolism
och00410  beta-Alanine metabolism
och00561  Glycerolipid metabolism
och00620  Pyruvate metabolism
och00625  Chloroalkane and chloroalkene degradation
och00903  Limonene and pinene degradation
och01100  Metabolic pathways
och01110  Biosynthesis of secondary metabolites
och01120  Microbial metabolism in diverse environments
och01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CES85_5003
   00053 Ascorbate and aldarate metabolism
    CES85_5003
   00620 Pyruvate metabolism
    CES85_5003
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CES85_5003
   00561 Glycerolipid metabolism
    CES85_5003
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CES85_5003
   00310 Lysine degradation
    CES85_5003
   00330 Arginine and proline metabolism
    CES85_5003
   00340 Histidine metabolism
    CES85_5003
   00380 Tryptophan metabolism
    CES85_5003
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CES85_5003
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CES85_5003
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CES85_5003
Enzymes [BR:och01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CES85_5003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DRTGG
Motif
Other DBs
NCBI-ProteinID: ASV84211
UniProt: A0A248UCU7
Position
2:complement(1196905..1198281)
Genome map
AA seq 458 aa AA seqDB search
MTNRFQPLFDTQREHFLSDTTKSYDWRIDQLNRMERMLRDNKDAFCAALYQDFHKPPFEQ
VFEITVPIGMIKYYRENLLDLMAPQPTPIPAGLEATGNSGVIYKEPYGVTLVIGPFNAPI
LLLLDPAIAALAAGNPVILKPANTTPVTASLLARLTPQYFAPENVSVVTGGREEIGELLQ
LPFDFIFFTGSSTVGKVVMRAAAENLTPIILELGGQNPTIVDATANLDVAADRIVWGHNA
ISGQWCIAPGYVYVHESVANVFTVKLKASIVRMYGEDPSQSTDFARMISEHDAERVASYI
LPEKVVHGGRYDVSSRYVEPTVLFPSTWDDPALQQELFGPVLPVMPYTDLNEIVGIIKRK
PTPLAAYIFSKDRTMVDFVLSSLSFGGSCVNQTNLHCWIDSLPFGGVGNSGMGKYYGKAG
FDALSNTKAMLMGNPDLEFDVFPPYAGKDIARNLSVFS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaccggttccagccattattcgacacacagcgcgagcatttcctaagcgacacg
accaagagctacgactggcgcatcgaccagctcaaccgcatggagcggatgctgcgcgac
aacaaagacgcgttttgcgccgcactctatcaggatttccacaagccacccttcgaacag
gtctttgaaatcactgtaccaatcgggatgatcaaatattatcgtgagaaccttcttgat
ttgatggcgccgcagcccactccgatcccggccgggctggaagcaactggcaatagcggc
gtaatttacaaggagccttatggcgtcacgctggtgatcggcccgttcaatgcaccaatt
cttcttctgctcgaccctgcgatagcggcactggccgctggcaacccagtcatccttaag
cccgccaataccacgccggttacggcgtcgctgttggcgaggttaacgccgcagtatttt
gcgccggagaatgtttcggtcgtgactggtgggcgcgaggaaattggcgagcttctgcaa
ctgccattcgatttcatcttcttcacaggttcgtcgacggtaggaaaagtagtgatgcga
gcagcggccgagaacctgaccccgatcatccttgaactcggtgggcagaaccctactatc
gttgatgcaactgccaatctcgacgttgccgccgatcgtattgtctggggtcacaacgca
atctccggccaatggtgtattgcgcccggctatgtctatgtccatgaaagcgttgctaat
gttttcaccgtaaagctcaaggcgtcgatcgttaggatgtacggtgaagacccaagccag
agtaccgactttgcgcggatgatcagcgagcatgacgcggaacgggttgcgagttacatc
ttgcccgaaaaggtcgtgcatggtgggcgctacgatgtaagttcacgatatgtcgagcca
accgtcctctttccttcgacatgggatgatccggcgctgcagcaggagctgtttggcccg
gttctgccagtcatgccctataccgatctcaatgaaattgtcgggatcataaagcgtaag
cccacaccacttgccgcctacatttttagcaaagatcggaccatggtagattttgtcctc
tcatcgctctcgttcgggggaagttgtgtcaatcaaaccaatttgcattgctggatcgat
agtttgccgttcggcggtgtcggcaatagtggcatgggcaaatattatggcaaagccggc
ttcgacgccctcagcaataccaaagcaatgttgatgggcaaccccgatcttgagtttgat
gtttttccgccttatgcaggcaaagacattgctaggaacttgagtgtgttttcgtaa

DBGET integrated database retrieval system