KEGG   Ochrobactrum sp. A44: CES85_5460Help
Entry
CES85_5460        CDS       T05040                                 

Definition
(GenBank) description family protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
och  Ochrobactrum sp. A44
Pathway
och03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:och00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CES85_5460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:och03400]
    CES85_5460
Enzymes [BR:och01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CES85_5460
DNA repair and recombination proteins [BR:och03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CES85_5460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_13 UvrD_C_2 Viral_helicase1 UvrD_C DUF4314
Motif
Other DBs
NCBI-ProteinID: ASV84665
UniProt: A0A248UD52
Position
2:complement(1650803..1651375)
Genome map
AA seq 190 aa AA seqDB search
MEIVKERIPRRFGVDPMRDIQVLCPMNRGGVGARSLNIELQKTLNPHGEPRVEKFGMTFA
VGDKVMQIENDYDKEVYNGDIGYVEGIDIDAGEMIIGFDERSISYLFGELDQIVLAYATT
IHKSQGSEYPVVVIPVLTQHYAMLQRNLIYTGVTRGKRLVILLGQKKAIAMAVRNTAGRR
RWSKLREWLT
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatcgtaaaagaacgtatcccccgccggttcggcgtcgatccaatgcgcgatatt
caggtgctctgcccaatgaaccggggtggcgtcggtgctcgttcgctcaacatcgaactt
caaaagaccttaaacccgcatggcgagccacgtgtggaaaaattcggtatgaccttcgcc
gtaggtgacaaggtgatgcaaattgaaaacgattatgacaaggaggtctataacggcgac
atcggctatgtcgaaggcatcgacattgacgcaggcgaaatgatcatagggttcgacgag
cgctctatctcctacctgttcggtgagcttgatcagattgttttggcctacgcgacgacg
atccacaaatcacagggatcggaatatccagtcgtcgtgatcccggttctcacccaacac
tacgccatgctccaacgaaacctgatttatactggtgtcacgcgtggaaaacgtctcgtt
atcctgctcggacagaaaaaggccattgccatggctgtgaggaatacagccggaaggcgg
cgttggtcaaagctgagagaatggctcacgtga

DBGET integrated database retrieval system