KEGG   Ochrobactrum sp. A44: CES85_5708Help
Entry
CES85_5708        CDS       T05040                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
och  Ochrobactrum sp. A44
Pathway
och00071  Fatty acid degradation
och00072  Synthesis and degradation of ketone bodies
och00280  Valine, leucine and isoleucine degradation
och00310  Lysine degradation
och00362  Benzoate degradation
och00380  Tryptophan metabolism
och00620  Pyruvate metabolism
och00630  Glyoxylate and dicarboxylate metabolism
och00640  Propanoate metabolism
och00650  Butanoate metabolism
och00900  Terpenoid backbone biosynthesis
och01100  Metabolic pathways
och01110  Biosynthesis of secondary metabolites
och01120  Microbial metabolism in diverse environments
och01130  Biosynthesis of antibiotics
och01200  Carbon metabolism
och01212  Fatty acid metabolism
och02020  Two-component system
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CES85_5708 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CES85_5708 (thlA)
   00640 Propanoate metabolism
    CES85_5708 (thlA)
   00650 Butanoate metabolism
    CES85_5708 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CES85_5708 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CES85_5708 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CES85_5708 (thlA)
   00310 Lysine degradation
    CES85_5708 (thlA)
   00380 Tryptophan metabolism
    CES85_5708 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CES85_5708 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CES85_5708 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CES85_5708 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:och04147]
    CES85_5708 (thlA)
Enzymes [BR:och01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CES85_5708 (thlA)
Exosome [BR:och04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CES85_5708 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASV84904
UniProt: A0A248UE17
Position
2:complement(1874653..1875837)
Genome map
AA seq 394 aa AA seqDB search
MSTPEIVIAAPVRTAIGAYNGKLKGMPATELGALVVRETLRRSGLEAGQIGSVVLGNVVQ
AGNRMNPARQASIGGGLPVSVPALTVNRVCGSGAQAILSAALEIVAGDSLAAIAGGMENM
DRAPYLLDGGRWGYRMGPAQILDSMLTDGLNDAFSGEHSGWHTEDLVAKLEIGREAQDAF
AARSQQRFAIASAAGHFADEILPVEIIGRKGTELFAIDEAPRPDTTMETLAQLKPAFRKD
GTITAGNAPGLNAGAAAVVVAERSFAERAGVEPVARLAGYGVGAIEPGLFGLGPVPAVQR
ALDKAGWSLGKVERFEINEAFAAVPLAIIKEMGLPEDIVNVDGGAVAHGHPIGATGAILT
TRLLHSLRRDGLSKGIVTLCIGGGQGIALAFELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccagaaattgttatcgcagccccggttcgcactgctattggggcttataac
ggcaagctgaaaggcatgccggccaccgaactcggagcacttgttgtccgcgagacccta
cgccggtcaggtctcgaggccgggcaaataggcagtgtcgttctcggcaatgtcgtccag
gccggcaaccggatgaacccggcacgtcaggcatccatcggcggcggcctgcctgtctcc
gttccagcgctgacggtcaatcgtgtctgcggctccggcgcacaagccattctttcagcc
gcgctggaaattgttgccggtgatagcctggctgcgatcgctggcgggatggagaatatg
gatcgagcaccctatttgctggatggcggacgctggggataccgcatgggacctgcccag
attctggatagcatgctgaccgatggcctcaatgatgccttctcgggcgagcactcaggt
tggcataccgaggatctggtggccaagcttgagatcggtcgcgaggcgcaggacgccttt
gcggcgcgatcccagcagcgtttcgcaatagccagcgcggctggacattttgcggacgaa
atcttgcccgtggagataattggtcggaaaggcacggaactttttgcgatcgacgaagcg
ccccgccctgacacgaccatggaaacgctggcccagctgaagcctgcctttcgcaaggat
ggaaccatcactgcgggcaacgcgccgggtctgaatgccggtgcggcagcagtggtcgtg
gcggagcgtagctttgccgaaagagccggcgtcgagcctgtcgcacgtctagccggttat
ggcgttggcgcgatcgaacccggcctctttggactaggccccgtgccggcggtgcaacgc
gccctcgacaaggcgggatggtcgcttggcaaggttgagcgtttcgaaatcaacgaagcc
ttcgccgccgtgccactcgcaatcatcaaagaaatggggctgccagaagacatcgtcaat
gttgatggtggtgcagttgcccatggccacccgatcggtgcgacgggtgcgatcctgaca
acccgtttgctgcattcgctgcgccgcgacggcctctctaaaggcatcgtcacgctttgc
atcggagggggacagggaattgcactcgcgttcgaactcatttga

DBGET integrated database retrieval system