KEGG   Oceanispirochaeta sp. K2: EXM22_03995Help
Entry
EXM22_03995       CDS       T06177                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ock  Oceanispirochaeta sp. K2
Pathway
ock00860  Porphyrin and chlorophyll metabolism
ock01100  Metabolic pathways
ock01110  Biosynthesis of secondary metabolites
ock01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ock00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EXM22_03995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ock01007]
    EXM22_03995
Enzymes [BR:ock01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     EXM22_03995
Amino acid related enzymes [BR:ock01007]
 Aminotransferase (transaminase)
  Class III
   EXM22_03995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 HTH_16
Motif
Other DBs
NCBI-ProteinID: QEN07191
UniProt: A0A5C1QHZ3
Position
886916..888154
Genome map
AA seq 412 aa AA seqDB search
MSANEKYKTSQDLFERAVKVIPGGIYGSKSPGFTVPGEFPYFFTEGEGCRVKDADGNSYI
DYLCGFGSMILGFGNSVVDDPAVVQLRKGDLLNCPSPVFVELAERLCKLIDGMGWSVFAK
NGSDATTLAVTMSRVHTGKRRVLMAKGAYHGSANWCSANEYPVLDDRDYVHTFPYGDEEA
LKELFDRYRDEIACIILTPYHHPTYTDQVLPQHTWYPLVESLCEKEHALFIMDDIRANFR
LSLHGSHHYFNAHPHLVTMGKSLANGYPIAALMGTPELKKAASSLFITGTFWTSSVPMVA
AMHCLKAMEEWDVQNHMNQMGKMLKDGLKSAAEAEGLKVNLSGPDAIPFMTFPDDPNLYH
NQIFSAAMARRGVYLHPHHNWFLSYAHKTEDIEETIDKAGDSFKEVKRHFSK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaatgaaaaatacaaaacaagtcaggatctgtttgagcgtgctgtaaaagtc
attcccggtggtatctatggatctaagagtcctggttttacggttcccggggagtttccc
tatttctttacagaaggggaaggctgccgggtcaaagatgcagacggcaacagttatatt
gattacctctgtgggtttggttctatgattctgggttttggaaactcagttgtggatgat
cctgcggttgttcaactccgaaaaggagatcttctcaattgtccctccccggtgtttgta
gaactggcagaacggctttgcaagcttattgatggaatgggttggtctgtttttgccaag
aatggttctgatgcaacaactcttgcggtcacaatgtcacgggttcatacgggtaaaaga
agagttctgatggctaaaggagcttatcacggctcagctaattggtgttctgccaatgaa
tatcctgttctggatgaccgggattatgtccatacatttccttatggagatgaagaagct
cttaaagaactctttgacagataccgggatgagatagcctgtatcatccttaccccctat
catcatcctacctacacagatcaggttcttcctcaacacacttggtatccccttgttgag
tctttgtgtgaaaaagaacatgcactgtttatcatggatgatattcgggccaatttccgt
ctttcccttcatggttcgcatcattatttcaatgctcatcctcaccttgtgaccatggga
aagtctttggctaacggatatcctattgcggctctcatgggaacgccggaacttaaaaaa
gccgctagtagtctttttattacgggaacattttggacttcttcggtacctatggtggca
gccatgcattgcctgaaggccatggaggaatgggatgttcaaaatcatatgaaccagatg
ggaaaaatgttaaaagacggactaaagagtgcagcagaagccgaagggttgaaggtcaat
ttatctggtcccgatgccattccatttatgacttttcctgatgatcccaatctctatcat
aaccagattttttcggcagccatggcgaggcggggggtctatctccatccgcatcacaat
tggttcttatcttatgctcataaaacagaagatatagaggaaactattgacaaagcagga
gatagttttaaggaagttaaaaggcatttttcaaagtag

DBGET integrated database retrieval system