KEGG   Oceanisphaera avium: CBP12_01925Help
Entry
CBP12_01925       CDS       T04855                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ocm  Oceanisphaera avium
Pathway
ocm00071  Fatty acid degradation
ocm00280  Valine, leucine and isoleucine degradation
ocm00310  Lysine degradation
ocm00362  Benzoate degradation
ocm00380  Tryptophan metabolism
ocm00620  Pyruvate metabolism
ocm00630  Glyoxylate and dicarboxylate metabolism
ocm00640  Propanoate metabolism
ocm00650  Butanoate metabolism
ocm00900  Terpenoid backbone biosynthesis
ocm01100  Metabolic pathways
ocm01110  Biosynthesis of secondary metabolites
ocm01120  Microbial metabolism in diverse environments
ocm01130  Biosynthesis of antibiotics
ocm01200  Carbon metabolism
ocm01212  Fatty acid metabolism
ocm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBP12_01925
   00630 Glyoxylate and dicarboxylate metabolism
    CBP12_01925
   00640 Propanoate metabolism
    CBP12_01925
   00650 Butanoate metabolism
    CBP12_01925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBP12_01925
   00072 Synthesis and degradation of ketone bodies
    CBP12_01925
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBP12_01925
   00310 Lysine degradation
    CBP12_01925
   00380 Tryptophan metabolism
    CBP12_01925
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBP12_01925
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBP12_01925
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBP12_01925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocm04147]
    CBP12_01925
Enzymes [BR:ocm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBP12_01925
Exosome [BR:ocm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP12_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ART79056
UniProt: A0A1Y0CVU7
Position
412867..414075
Genome map
AA seq 402 aa AA seqDB search
MSEPVYIVAAKRTPIGSFCGALKSVPAAELAGIAIKGALEQAGLNPEHVNEVIVGNVISA
GQGMGVGRQAALAAGIPVGIPAYSLNMVCGSGMKTLMDACAHIKAGDADVVVAAGCENMS
QIPFIAKGDLRNGHKMGDMALSDLLINDGLTDVFNNYHMGVTAENVVEQENISRDEQDAL
AVASQTKAVAAIKAGNFKDEIVAVEVKGRKETVTVDTDEYPKEGTSVESLARLRPAFKRD
GSVTAGNASGINDGGSAIIVASKSAVEKYGLTPLAEVVGYGQGGLDPAVMGLGPVPAIKQ
ALSRAELTLDQMERLELNEAFAGQALGVVKQLSHQHDIAEQALLDKTNVNGGAIALGHPL
GASGNRILVTLLYELQRSKTELGLASLCVGGGMGTAVILKRV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacctgtttatattgttgcagcaaaacgtacccctattggtagtttttgtggt
gcattaaaaagcgttcccgcggctgagctggcaggaattgcgatcaaaggcgcgcttgag
caagcgggcttaaatcctgagcatgttaatgaagtgattgtgggtaacgtaatcagcgct
ggccaaggcatgggtgtaggtcgtcaagctgcgctagcggcgggtatccccgtaggcatt
cctgcctatagcttaaacatggtatgtggcagtggcatgaaaaccttaatggatgcctgt
gctcatattaaagccggtgatgcagatgtagtggtcgccgctggctgtgaaaacatgtca
caaattccgtttattgctaaaggcgatttgcgcaatggccacaaaatgggtgacatggcg
ctaagtgatttgctgattaatgacggtcttaccgatgtgtttaataactatcacatgggt
gtcaccgcagaaaacgtggttgaacaagaaaacattagccgtgatgagcaagatgcactg
gccgtagctagccaaactaaagcggtggctgctattaaagccggtaatttcaaagatgaa
attgttgccgttgaagtgaaaggtcgtaaagaaacagtgaccgtagataccgacgagtat
cctaaagagggcactagcgttgagtcgctagcgcgcttgcgtcctgcttttaagcgcgat
ggctcagtaacagccggtaatgcgtcgggtatcaacgacggtggtagtgctattattgtt
gctagcaagtcagccgtagaaaagtatggcttaacgccgttggcagaggtggtgggttat
ggccaaggtggtcttgatcctgctgtgatgggcttaggtccggtgccggcgattaagcag
gctttatcacgtgccgagctaacgctggatcaaatggagcgtttagagctaaacgaagcc
tttgccggtcaagcgttgggtgtggtgaaacagctgtctcatcagcatgacattgcagag
caagccttgttagataagaccaacgttaatggcggtgctattgcactgggccatccgtta
ggtgcctctggcaaccgcattctggttactttgctctatgaattgcaacgcagtaaaact
gagctaggcttagcttcactgtgtgtgggtggtggtatggggacggccgttattcttaaa
cgcgtttaa

DBGET integrated database retrieval system