KEGG   Oceanisphaera avium: CBP12_07110Help
Entry
CBP12_07110       CDS       T04855                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ocm  Oceanisphaera avium
Pathway
ocm00230  Purine metabolism
ocm00250  Alanine, aspartate and glutamate metabolism
ocm01100  Metabolic pathways
Module
ocm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CBP12_07110
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBP12_07110
Enzymes [BR:ocm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CBP12_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ART79945
UniProt: A0A1Y0CYP0
Position
complement(1549913..1551229)
Genome map
AA seq 438 aa AA seqDB search
MGQNVVVLGTQWGDEGKGKVVDLLTNKARYVVRYQGGHNAGHTLVIDGKKTVLHLIPSGI
LRENCTCIIANGVVLSPEALLKEMAGLEASGIPVRERLVLSEACPLILQYHVAMDQAREV
ARGANAIGTTGRGIGPAYEDKVARRGLRVGDLANMDTFAIKLKEVIDYYNFQLTGLYGVE
AVCYDTVLEEAKGYAELLTSMVIDVTDVLDVARKNGDKIMFEGAQGTLLDIDHGTYPFVT
SSNTTAGGVATGSGFGPCYIDYVLGIIKAYTTRVGSGPFPTELYDGQEKLDAAGKHLGTV
GHEFGATTGRLRRTGWLDLVTIKRAIQVNSISGFCLTKLDVLDGLKELKICVGYKMPDGS
VKDVPPMAAEDYETVTPVYETMPGWSENTVGVVTLEDLPQAARNYIKRIEELTGVPIDII
STGPDRDETLILRHPFEA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaaacgttgtggtactaggcacccagtggggtgacgagggtaagggtaaggtc
gttgaccttctgactaacaaagcccgttatgtggtgcgttatcaaggtgggcacaatgct
ggccatactctggtaattgacggtaaaaaaaccgttctccaccttattccatcaggtatt
ttgcgcgaaaactgtacttgcatcattgctaatggtgtagtgctgtcacccgaggctttg
ctcaaggaaatggctgggcttgaagccagcggtattccagtgcgtgagcgcttggtactg
agcgaagcttgtccattgatcctgcaatatcatgtcgctatggaccaagctcgcgaagta
gcgcgtggcgccaatgctattggcaccaccggccgtggtatcggtcctgcctacgaagac
aaggtagcgcggcgcgggttacgtgttggcgatttagcgaacatggatacctttgccatt
aaattgaaagaagttattgattactacaactttcaattaaccggtttatacggtgtagag
gcggtgtgctatgacaccgtattggaagaagcaaaaggctatgccgagctgctaaccagt
atggtaattgatgtcactgatgtgctggatgtggctcgcaaaaacggtgacaagatcatg
tttgagggcgcgcaaggcacgctgcttgatatcgatcatggtacctacccgtttgtgact
tcctctaacaccacagccggtggcgtggcgacgggctctggttttggcccctgctacatt
gactatgtgttaggtattatcaaagcctataccacgcgtgttggctcaggtcctttccct
actgagttgtatgacggtcaagaaaaactggatgcagctggtaagcacttagggacagtg
ggccatgagtttggtgctactacgggccgcttgcgccgtacgggctggttagacttagtc
accatcaagcgcgctatccaagtaaactctatttcaggtttttgcttaaccaagttagat
gtattagatggcttgaaagagttaaaaatctgtgtgggctacaagatgccagatggctct
gtaaaagatgtgccgcccatggccgctgaagactatgagacagtgacgcctgtgtatgaa
actatgccaggttggagcgaaaatactgtgggtgtggtgactttagaagacttgccacaa
gctgcgcgtaattacattaagcgcattgaagagctgaccggggtaccgattgatattatt
tcaaccggtcctgatcgtgatgaaacacttattttgcgccatccctttgaagcttaa

DBGET integrated database retrieval system