KEGG   Oceanisphaera avium: CBP12_08450Help
Entry
CBP12_08450       CDS       T04855                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ocm  Oceanisphaera avium
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ocm03009]
    CBP12_08450
Enzymes [BR:ocm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CBP12_08450
Ribosome biogenesis [BR:ocm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CBP12_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS Ubie_methyltran Methyltransf_32 PCMT Methyltransf_24 Methyltransf_9 Methyltransf_33 CheR PrmA Methyltransf_18 Methyltransf_29 Pox_MCEL
Motif
Other DBs
NCBI-ProteinID: ART80175
UniProt: A0A1Y0CZD2
Position
complement(1831410..1832240)
Genome map
AA seq 276 aa AA seqDB search
MSYQCPLCHLALTPRVGGLECENNHQFDRAKEGYVNLMPVQHKRSKEPGDNVEMMQARRR
FLATEHYHPLRQAVVDLCLHYTQHTPRQILDIGCGEGYYTAFLANALMAQSQCATCYGLD
ISKVAIRYAAKRYSSPHMQFCVASSQRLPFADHSLNAIVRIYAPCEALELARVLNKQGVV
ITVTPAARHLYQLKELIYENVHLHDETSEELAGFALIAATKLTYDMALTGEQADDLLQMT
PFAWKASLEVRQALTAMAELKCDADFMLRVYQKISH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcagtgtccgctttgtcatttggctcttactcctcgggtaggtgggttagag
tgcgaaaataaccaccaatttgatcgcgctaaagaaggctacgttaacctaatgccggtg
cagcataaacgctctaaagagccgggcgataatgtggagatgatgcaggcgcgccgacgg
tttttagccacagagcattatcatccgctgcgccaagctgtagtcgatttgtgtttgcac
tacacccaacatacgcctcgtcaaatactagatattggttgtggtgaagggtactacacc
gcttttctggcaaatgcactcatggcgcagtcacagtgtgccacttgttatggcttagat
atttcaaaagttgcaattcgttatgctgcaaagcgatatagctcgcctcatatgcagttc
tgtgtggcttctagtcagcgcttaccttttgccgatcacagcctgaatgccattgtccgc
atttatgccccctgcgaggcgctagagctggcgcgagtattaaacaaacaaggggtggtt
atcacagtcacgcccgccgcgcgccacctttaccagcttaaagagctgatttatgaaaac
gtgcacttgcacgatgaaacaagtgaagagctagccggatttgcgctaatagcagcaact
aagctgacttacgacatggcattaaccggtgagcaagctgatgacctcttacaaatgacc
ccgtttgcttggaaggccagccttgaggtgcgccaagcgttaaccgctatggcggagcta
aaatgtgacgccgattttatgttacgggtttatcaaaaaataagtcactag

DBGET integrated database retrieval system