KEGG   Oceanisphaera avium: CBP12_09875Help
Entry
CBP12_09875       CDS       T04855                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ocm  Oceanisphaera avium
Pathway
ocm00860  Porphyrin and chlorophyll metabolism
ocm01100  Metabolic pathways
ocm01110  Biosynthesis of secondary metabolites
Module
ocm_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CBP12_09875
Enzymes [BR:ocm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CBP12_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ART80413
UniProt: A0A1Y0CYK6
Position
complement(2143620..2144990)
Genome map
AA seq 456 aa AA seqDB search
MTAQIEWDQALIEKYNYSGPRYTSYPTAMEFSENFGMPELEAAAARYPERPLSLYVHIPF
CHKLCYYCGCNKVITRHQSKADPYLDYLELEIKRLAPLFAGRTVTQLHWGGGTPTFLTEP
QIRRLNSLLRENFNFAEQGEYSLEIDPRKIELSLLEVLKEVGFNRISLGVQDFNKAVQQM
VNREQDNDFIKALVVRAAELGFTSTNLDLIYGLPLQTPESFQHTLKEIVALKPARLSVFN
YAHLPSRFAAQRKLNPADMPSPANKLLMLEQSINFLTEQGYQFIGMDHFALPDDTLAIAQ
REGKLHRNFQGYTTQGECDLLGLGVSAISMLGDAYSQNHKDLKEYYAQLDNLGHAQAVGY
ALNTDDCIRRDLIKTLICDFELAFAPLEAEYDIVFADYFAEDLKLLQTFIDDELVTMTDT
HINVTLKGELLIRNICMCFDVHLRRETRMRQFSRVI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacaaattgagtgggatcaggcgctgatcgagaaatacaattattctggacct
cgttatacttcgtatccaacggcaatggaatttagtgaaaactttggtatgccggagtta
gaagcggcagcggcgcgctatcctgagcggcccttgtcactttatgtgcatattcctttc
tgtcataagctttgttactactgcggttgtaataaggtgattactcgccaccagagtaaa
gccgatccttaccttgattatttagagttagaaattaaacgactagcgccgctgtttgcg
gggcgtaccgtcactcaactgcactggggcggtggcacaccgacttttttaactgagccg
caaattcgtcgcttaaatagcctattacgtgaaaattttaattttgccgaacaaggtgaa
tatagccttgaaattgatccgcgaaaaattgagctgagcctacttgaagtgctaaaagaa
gtgggctttaatcgcatcagcttaggggtgcaagattttaataaagcggtacaacagatg
gtgaaccgcgagcaagacaacgactttattaaggcgttggtggtacgcgccgccgagtta
ggttttacttcaactaacctcgatttaatttacggcttgccactgcaaactcctgaaagt
tttcagcacaccttaaaagaaattgtggcgctaaaacccgcgcggttgtcggtctttaac
tatgcccacttacctagtcgttttgccgcccagcgcaagcttaatccggcagatatgcca
agtcccgctaataagttactgatgcttgagcaaagcattaactttttaaccgagcagggc
tatcagtttattggcatggatcactttgcactacccgacgacaccttagccatcgctcag
cgcgaaggtaagttgcaccgcaacttccaagggtacactactcaaggtgagtgtgacttg
ctgggcttaggggtatcggccatcagcatgttaggtgatgcctactcacaaaatcataaa
gacttaaaagagtattacgcacagctcgataatctaggtcacgcccaagcagtgggttat
gcgcttaatactgatgactgtatccgccgtgatcttattaagacgctaatttgtgatttt
gagttagcatttgcgccactggaagcagagtacgatattgtatttgctgactattttgct
gaagaccttaagctgctgcaaacttttatcgacgatgaattagtgaccatgactgacact
catattaacgtcaccttaaaaggcgagctgttaattcgcaatatttgcatgtgttttgat
gtgcacttgcgccgtgaaacccggatgcgccaattctccagagtgatctag

DBGET integrated database retrieval system