KEGG   Oceanisphaera avium: CBP12_11285Help
Entry
CBP12_11285       CDS       T04855                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ocm  Oceanisphaera avium
Pathway
ocm00220  Arginine biosynthesis
ocm01100  Metabolic pathways
ocm01110  Biosynthesis of secondary metabolites
ocm01130  Biosynthesis of antibiotics
ocm01230  Biosynthesis of amino acids
Module
ocm_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CBP12_11285
Enzymes [BR:ocm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CBP12_11285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: ART80656
UniProt: A0A1Y0D0M8
Position
2464160..2465077
Genome map
AA seq 305 aa AA seqDB search
MQHLLSLKDYSKQQIEDILALAKDLKAHPEKYADALKGQSVVTLFEKPSLRTRVTLDIGI
NRLGGHAVYLDSQNGAMGSRETVQDFAANLSRWCQAIVARVFDHQTLVEMAKYAKVPVIN
SLCNLYHPCQALADYMTIAEHHEDLSKVHLVYLGDGNNVTNSLLLAGAILGATVTSVCPR
GRNVDAQVLKEAEALAELSGGKVQVADSLDDITDIDVLYTDTWVSMGDDTPLEQVAETFM
PYQINQALLDKTGAKQVLHCQPAHREMEITSEVMDGPASFILDQAENRMHVQNAVLLTLM
NRDTH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatttattaagcctaaaagattatagtaagcagcaaattgaagatatcttggcg
ctggctaaagacttaaaagcccatccagaaaaatatgccgatgctttgaaaggtcaaagt
gtggttacgctgtttgaaaaaccttcgttgcgtactcgcgtaacgctcgatattggtatt
aaccgcttaggcgggcatgcggtttatttagatagtcaaaatggcgctatgggcagccgt
gaaaccgtacaagattttgccgctaacctctctcgctggtgccaagcgatagtagcacgg
gtgtttgatcaccaaacgctggtagaaatggcaaaatatgccaaagttccagtaatcaat
tccttatgtaacctgtatcatccttgtcaggcgttggcagattatatgaccatagccgag
caccatgaggatctgagtaaggtacatttagtctatctgggtgatggtaataatgtaact
aattcattattactggccggtgcgattttaggcgccaccgttacctcggtgtgcccgcgt
ggacgcaacgtggatgcccaagtattaaaagaagccgaagcgctagctgaactaagtggt
ggcaaagtgcaagtggctgatagccttgatgatattactgatatcgatgtgttatacaca
gatacttgggtgtcgatgggtgatgacacgccgcttgagcaagtggctgaaacttttatg
ccttatcagatcaatcaagcgctgcttgataaaaccggtgctaagcaggtattacattgc
cagcctgcgcaccgagaaatggaaataacttctgaggtaatggacggtcctgcttccttt
atcctcgaccaagctgaaaatcgcatgcatgtgcaaaatgccgtgctgctgacattgatg
aatagggatacccactaa

DBGET integrated database retrieval system