KEGG   Oceanobacillus sp. 160: CUC15_00685Help
Entry
CUC15_00685       CDS       T05570                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ocn  Oceanobacillus sp. 160
Pathway
ocn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ocn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CUC15_00685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ocn03011]
    CUC15_00685
Ribosome [BR:ocn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CUC15_00685
  Bacteria
    CUC15_00685
  Archaea
    CUC15_00685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXI07598
UniProt: A0A345PC68
Position
133177..133518
Genome map
AA seq 113 aa AA seqDB search
MQAKAIAKSVRIAPRKVRLVVDLIRGKNVGEAVAILRHTQRGASPVVEKVLKSAIANAEH
NYEMDPDNLVISEAYVNEGATLKRFRPRAQGRASKINKRTSHITVVVTEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagccatagctaaatcagttcgtatagctcctcgtaaagttcgattagtt
gttgatcttattcgaggaaaaaacgtaggcgaagcagttgcaatactccgtcatacacaa
cgtggtgcttctccagtcgtagagaaagttttgaagtctgcaatcgcaaacgctgaacac
aactacgaaatggatccagataatctagtaatatctgaagcatatgttaatgagggtgct
acattgaaacgtttccgtccacgcgcacaaggacgtgcaagcaaaattaataaacgcaca
agccacatcacagtagtggtaacagaaaagaaggagggatag

DBGET integrated database retrieval system