KEGG   Oligotropha carboxidovorans OM4: OCA4_c14950Help
Entry
OCA4_c14950       CDS       T01967                                 

Gene name
sucC2
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00020  Citrate cycle (TCA cycle)
oco00640  Propanoate metabolism
oco00660  C5-Branched dibasic acid metabolism
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01120  Microbial metabolism in diverse environments
oco01130  Biosynthesis of antibiotics
oco01200  Carbon metabolism
Module
oco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCA4_c14950 (sucC2)
   00640 Propanoate metabolism
    OCA4_c14950 (sucC2)
   00660 C5-Branched dibasic acid metabolism
    OCA4_c14950 (sucC2)
Enzymes [BR:oco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OCA4_c14950 (sucC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A
Motif
Other DBs
NCBI-ProteinID: AEI02635
Position
1616120..1617292
Genome map
AA seq 390 aa AA seqDB search
MNLHEFQAKQILAGYGLPSPGGKVAITAEQAVAIYNELGGGDMAVKAQVHAGGRAQAGGV
KIVHSEKEAKAVATSLLGKKLVTAQTGPAGRVVRRIYLEKAVEPVRELHVALLIDGSSGT
LTLFGSARGGDDIEERAARGELRLERLSLGDGSKRQADNVAAFATRIRIDAGSVAAFEKI
VDGLRRAFVDLDASLIEINPLAILRDGSFQALDVKMVLEDNALFRHPDLTALRDEDEIDH
REVEAQRHQLNFVSMDGNIGVVANGAGLGLASVDLVCAAGGKPANFMDIRTTATSLDVAY
GFGLLLDNPATRAIFLNVHGGGMQPCDTIAEGLGIAMRRTGRSLPIVARLAGNNAEFARS
RFVNFGCPVVDCPDMWTAATKVVAIAQKGG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctgcacgagtttcaggccaaacaaatcctggcgggctacgggttgccctcgccg
ggcggcaaggttgccatcacagccgaacaggctgtcgccatttataatgagctcggcggc
ggtgacatggccgtcaaggcgcaggtccatgccggtggccgcgcacaggcgggcggcgtc
aagatcgtccattccgagaaagaggcaaaggcggtcgcgacctcgctgctcggcaagaag
ctcgtcaccgcgcagaccggcccggccgggcgcgtggtccggcgcatctatctcgaaaag
gcggtcgagcccgtgcgcgagctgcacgtcgcactcctgatcgacggctcctccggtacc
ctcacattgttcggcagcgcccgtggcggcgacgatatcgaggagcgtgccgcgcgcggc
gagttgcggctcgagcgtctcagcctcggcgatggctccaagcggcaggccgacaacgtc
gcggcttttgcgacgcgcatccgcatcgatgccggttcggtggcggccttcgagaagatc
gtcgatggcctgcgccgcgcctttgtcgatctcgacgcaagcctgatcgaaatcaacccg
ctcgcgatcctgcgcgacggcagcttccaggcgctcgacgtcaagatggtgctggaagac
aacgcgctgttccgccatcccgacctcaccgcactgcgcgatgaggacgagattgatcat
cgcgaggtcgaggcgcagcgccaccagctcaacttcgtcagcatggacggcaatatcggc
gtggtcgccaacggcgcgggcttaggccttgcgagcgtcgacctcgtctgtgcggcgggc
ggcaagcccgcgaacttcatggatatccgcaccacggcgacgagcctcgatgtcgcctac
ggcttcggcctcctgctcgacaatcccgcgacgcgtgcgattttcctcaatgtccacggc
ggcggcatgcagccttgcgacaccatcgcggaaggcctcggcatcgccatgcgccgcacc
ggccgctcgttgccgatcgtggcgcggctcgctggcaacaacgccgagttcgcgcgttcg
cgcttcgtcaatttcggttgcccggtcgtcgattgtccggacatgtggacggccgcgacc
aaggtcgtggccattgcgcagaagggaggatga

DBGET integrated database retrieval system