KEGG   Oligotropha carboxidovorans OM4: OCA4_c17490Help
Entry
OCA4_c17490       CDS       T01967                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00010  Glycolysis / Gluconeogenesis
oco00020  Citrate cycle (TCA cycle)
oco00620  Pyruvate metabolism
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01120  Microbial metabolism in diverse environments
oco01130  Biosynthesis of antibiotics
oco01200  Carbon metabolism
Module
oco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA4_c17490 (pdhC)
   00020 Citrate cycle (TCA cycle)
    OCA4_c17490 (pdhC)
   00620 Pyruvate metabolism
    OCA4_c17490 (pdhC)
Enzymes [BR:oco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     OCA4_c17490 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H ATP-synt_ab_Xtn QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AEI02887
Position
1896129..1897502
Genome map
AA seq 457 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVSSGDVIAEIETDKATMEVEAVDEGTIAKIL
VPEGTADVPVNQVIAVLAADGEDVKAAASGGGASAPAPKPAEAPKAAEPAKAAEAPKPAA
AASAPAPAAKPTASAAPAAPQPAQAPSNGARTFASPLARRLAKEAGIDISRVSGTGPHGR
IIARDVDEAKAGRGLKPAAAGGAAAPTFAPGPSDAQIMSLFNADNYEAVPHDQMRKVIAQ
RLSASDRDVPQYYLTCDCDIGNLVAAREDINGRAPKDKDGKPAYKLSVNDFVIKALALAL
QRVPDANVTWTDEAMLRHKVSDVSVAVSIPTGLITPIIRSAHAKSVSTISNEMKDLAARA
KARKLKPEEYQGASTAVSNLGMYGMKQFTAVINPPQSTILAVGMSEERPVVRNGKIEIAT
IMTVTLTCDHRAMDGALGAQLLSAFKLLIENPVMMVV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacattctgatgcccgcgctgtcgcccacgatggaaaagggcaacctcgcc
aagtggctcaagaaagagggcgacaaggtttcatccggcgatgtcatcgccgagatcgag
accgacaaggcgacgatggaagtcgaggcggtggacgagggcaccatcgcgaaaattctg
gtaccggaaggcaccgccgacgtgccggtcaatcaagtcatcgccgtgctcgccgccgat
ggcgaggatgtgaaagcggctgcaagcggtggcggtgcatctgcgccggctcccaagcct
gctgaagctccgaaagctgctgaaccggccaaggctgcagaggctccgaagcctgctgcc
gctgcgtccgcaccggctccggctgcaaaaccgaccgcatctgcggcaccggctgcgccg
cagcccgcacaggctcccagcaacggcgcgcgcacctttgcctcgccgctcgcccggcgt
ctcgccaaggaagctggcatcgatatttcccgcgtcagcggcaccggtccacacggccgc
atcatcgcccgcgacgtcgacgaggcgaaggcggggcgtggtctgaagcctgccgctgct
ggcggcgcggctgcgccgaccttcgcgccgggtccgagcgacgcgcagatcatgtcgctg
ttcaatgcggacaattacgaggcggtgccgcacgaccagatgcgcaaggtgattgcgcag
cgtctgtcggcctccgaccgcgacgtgccgcaatattatctcacctgcgattgcgacatc
ggcaatctcgtcgccgcgcgcgaggacatcaacggccgcgccccgaaggacaaggacggc
aagcccgcctacaagctctcggtcaacgacttcgtcatcaaggcgctggcgctggcgttg
cagcgcgtgccggatgccaacgtcacctggaccgacgaggcgatgctgcgccacaaggtc
tccgacgtctcggtcgcggtgtcgatcccgaccgggctgatcacgccgatcatccgcagc
gcgcatgcgaagtcggtgtcgacgatctccaacgagatgaaggacctcgccgcgcgcgcc
aaggcacgcaagctcaagcccgaggaatatcagggcgcgagcacggcggtgtcgaacctc
ggcatgtacggcatgaagcagttcaccgccgtcatcaacccgccgcagtcgaccattctc
gcggttggcatgagcgaggagcggccggtggtgcggaacggcaagatcgagatcgcgacc
atcatgacggtgacgcttacatgcgatcaccgcgcgatggacggcgcgctcggtgcgcag
cttctcagcgccttcaagctcctgatcgaaaacccggtgatgatggtggtgtga

DBGET integrated database retrieval system