KEGG   Oligotropha carboxidovorans OM4: OCA4_c29240Help
Entry
OCA4_c29240       CDS       T01967                                 

Definition
(GenBank) thiolase domain protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00071  Fatty acid degradation
oco00072  Synthesis and degradation of ketone bodies
oco00280  Valine, leucine and isoleucine degradation
oco00310  Lysine degradation
oco00362  Benzoate degradation
oco00380  Tryptophan metabolism
oco00620  Pyruvate metabolism
oco00630  Glyoxylate and dicarboxylate metabolism
oco00640  Propanoate metabolism
oco00650  Butanoate metabolism
oco00900  Terpenoid backbone biosynthesis
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01120  Microbial metabolism in diverse environments
oco01130  Biosynthesis of antibiotics
oco01200  Carbon metabolism
oco01212  Fatty acid metabolism
oco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCA4_c29240
   00630 Glyoxylate and dicarboxylate metabolism
    OCA4_c29240
   00640 Propanoate metabolism
    OCA4_c29240
   00650 Butanoate metabolism
    OCA4_c29240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCA4_c29240
   00072 Synthesis and degradation of ketone bodies
    OCA4_c29240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCA4_c29240
   00310 Lysine degradation
    OCA4_c29240
   00380 Tryptophan metabolism
    OCA4_c29240
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCA4_c29240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCA4_c29240
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OCA4_c29240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oco04147]
    OCA4_c29240
Enzymes [BR:oco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCA4_c29240
Exosome [BR:oco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCA4_c29240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEI04034
Position
3112061..3113230
Genome map
AA seq 389 aa AA seqDB search
MSINGAAYIVGAYEHPTRKAPDKSLGQLHAEVAKGALDDAGLTKDDVDGYFCAGDASGLG
PLSMLDYLGLDVRHMDSTDTGGSSYLLHVAHAAEAIAMGKCRIALITLAGRPRSQASTIG
TVPHVFTDDAPDVPFEHPYRPVISNLYAMCAMRHMYEFGTTSEQLAWIKVAASHHAQHNP
HAMLPNVVTVDDVLASPMVASPLHKLDCCVVSDGGGAIIVAHPDIAKSLRRPKVKLRGAG
EAIQHQMGGRINLTTSAAARSGPIAFAEAAVTPTDIKYASIYDSFTITVLIQLEDLGFCE
KGKGGAFVADGNLISGVGKLPFNTDGGGLCNNHPANRGGMTKIIEAVRQLRGEAHPAVQV
PGCDLALVQATGGRLGTRHVSGTLILERE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaacggcgcagcttatattgtcggcgcttacgaacaccccacccgcaaagcg
cccgacaaatcgcttgggcaactccatgcggaggtcgcaaagggcgcgctcgacgatgcc
ggcctgaccaaggacgacgttgacggctatttctgcgcaggcgacgcctccggcctcggc
cctctatccatgctggactatcttggacttgatgtccggcacatggattcgaccgatacc
ggcggctcatcctatctgcttcatgtcgcgcatgcggccgaagccatcgcgatgggcaaa
tgccggatcgccctcataacgctggccggccgcccgcgctcgcaggcatccaccattggc
accgtcccgcatgtcttcacggatgatgcgccggatgttccgttcgaacatccctatcga
ccggttatcagcaatctctacgccatgtgcgctatgcgccacatgtacgaattcggcacc
acctcggagcagcttgcctggatcaaggttgcggcctcccaccacgcccagcataacccg
catgccatgctaccgaatgttgtcaccgtcgatgacgtgctggcttcaccaatggtcgcc
tcgccgctccataaactcgattgctgcgtggtgtcggacggcggcggtgccatcattgtc
gctcatcccgatatcgcgaaatccttgcggcgcccgaaggtcaaacttcgtggcgcaggc
gaagccatccagcatcagatgggtggccgcattaatctgacaacatcggcagccgcacgc
tcgggcccgatcgctttcgccgaggccgcagtcacaccgacggatatcaaatacgcctcc
atctatgacagcttcacgatcaccgtgctgatccaactcgaagatctagggttttgcgag
aagggcaaaggcggtgcgtttgtcgcggacggcaacctgatctccggtgtcggcaagctt
cctttcaacacggatggcggcggcctctgcaacaatcatcccgccaatcgtggcgggatg
acgaagattattgaagccgtgcggcagttacgcggtgaagcccatcctgccgtgcaggtt
ccgggttgcgatctggctttggtgcaagctaccggaggccgcctcggcacgcgccacgtc
agcggtacgcttattctggagcgcgaatag

DBGET integrated database retrieval system