KEGG   Oryctolagus cuniculus (rabbit): 100008647Help
Entry
100008647         CDS       T03373                                 

Gene name
F10
Definition
(RefSeq) coagulation factor X
  KO
K01314  coagulation factor X [EC:3.4.21.6]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100008647 (F10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100008647 (F10)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008647 (F10)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     100008647 (F10)
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100008647 (F10)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   100008647 (F10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition EGF Trypsin_2 cEGF DUF1986 hEGF EGF_2 EGF_3 Plasmod_Pvs28 EGF_CA
Motif
Other DBs
NCBI-GeneID: 100008647
NCBI-ProteinID: NP_001075485
Ensembl: ENSOCUG00000022738
UniProt: O19045
Position
Un
AA seq 490 aa AA seqDB search
MANPLHLVLLGAALAGLLLSGSSVFISRRAANDVLARTRRANSFLEELKKGNLERECMEE
NCSYEEALEVFEDREKTNEFWNKYVDGDQCESNPCQNQGTCKDGLGMYTCSCVEGYEGQD
CEPVTRKLCSLDNGGCDQFCKEEENSVLCSCASGYTLGDNGKSCISTELFPCGKVTLGRW
RRSPATNSSEGPPEAPGPEQQDDGNLTATENPFNLLDSPEPPPEDDSSSLVRIVGGQDCR
DGECPWQALLVNEENEGFCGGTILSEYHVLTAAHCLHQAKRFKVRVGDRDTEHEEGNEET
HEVEVVVKHNRFVKETYDFDIAVLRLKTPITFRRNVAPACLPQKDWAESTLMAQKTGIVS
GFGRTHEMGRLSTTLKMLEVPYVDRNSCKRSSSFTITQNMFCAGYDARPEDACQGDSGGP
HVTRFRDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIEKSMRARAVPVAEAAGTPGP
TQPTIKGSPS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccaacccactgcacctcgtcctgctcggcgccgccctagccggcctcctgctgtcc
gggagcagtgtgttcatcagccggcgggccgccaacgacgtgctggcgaggacgcggagg
gcgaactcatttctggaggagctgaagaaaggaaacctggagagggagtgcatggaggag
aactgctcctacgaggaggcccttgaagtcttcgaggacagggagaagacgaatgagttc
tggaacaaatacgtagatggcgaccagtgtgagagcaatccgtgccagaaccagggcacg
tgcaaagatggcctcgggatgtacacgtgctcctgtgtggaaggctacgaaggccaagac
tgcgaacctgtcacacgcaaactgtgcagcctggacaacgggggctgcgaccagttctgc
aaggaggaggagaactcagtgctgtgttcctgcgccagcgggtacaccctgggtgacaac
ggcaagtcctgcatctccacagagctcttcccctgtgggaaagtcaccctgggacgctgg
aggaggtcgccggccaccaacagcagcgagggccccccggaagcccccggtccggagcag
caggacgacggcaacctgaccgccaccgagaaccctttcaacctgctggactccccggag
ccgccgcccgaggacgacagcagcagcttggtgcgcatcgtgggcggccaggactgcaga
gacggcgagtgcccctggcaggcactcctggtcaatgaggagaacgaagggttctgtggg
ggcacgatcctgagcgagtaccacgtcctcacggcggcccactgcctgcaccaggccaag
aggttcaaggtgagagtaggggaccgggacacggagcacgaggagggcaacgaggagacc
cacgaggtggaggtggtcgtgaaacacaacaggtttgtgaaggagacgtacgacttcgac
atcgcggtgctcaggctgaagacgcccatcaccttccgcaggaacgtggcccccgcctgc
ctgccccagaaggactgggccgagtccacgctgatggcccagaagacgggcatcgtgagc
ggcttcggccgcacgcacgagatgggccgcctgtccaccaccctcaagatgctcgaggtg
ccctacgtggaccgcaacagctgcaagcgttccagcagcttcaccatcacccagaacatg
ttctgcgctggctacgacgccaggcccgaggacgcctgccagggggacagcgggggcccc
cacgtcacccgcttcagggacacctactttgtgacgggcatcgtcagctggggggagggg
tgcgcaaggaaggggaagtttggggtctacaccaaggtcagcaacttcctcaagtggatc
gagaagtcaatgagggccagggctgtccctgtggcggaggcggccgggaccccggggccc
acacagcccaccattaaagggagcccctcctga

DBGET integrated database retrieval system