KEGG   Oryctolagus cuniculus (rabbit): 100008695Help
Entry
100008695         CDS       T03373                                 

Gene name
INMT
Definition
(RefSeq) indolethylamine N-methyltransferase
  KO
K00562  methyltransferase [EC:2.1.1.49 2.1.1.96]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00380  Tryptophan metabolism
ocu00450  Selenocompound metabolism
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    100008695 (INMT)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100008695 (INMT)
Enzymes [BR:ocu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.49  amine N-methyltransferase
     100008695 (INMT)
    2.1.1.96  thioether S-methyltransferase
     100008695 (INMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NNMT_PNMT_TEMT Methyltransf_23 Methyltransf_12 Methyltransf_11 Methyltransf_25 Pox_MCEL
Motif
Other DBs
NCBI-GeneID: 100008695
NCBI-ProteinID: NP_001075512
UniProt: O97972
Position
10
AA seq 263 aa AA seqDB search
MEGGFTGGDEYQKHFLPRDYLNTYYSFQSGPSPEAEMLKFNLECLHKTFGPGGLQGDTLI
DIGSGPTIYQVLAACESFKDITLSDFTDRNREELAKWLKKEPGAYDWTPALKFACELEGN
SGRWQEKAEKLRATVKRVLKCDANLSNPLTPVVLPPADCVLTLLAMECACCSLDAYRAAL
RNLASLLKPGGHLVTTVTLQLSSYMVGEREFSCVALEKEEVEQAVLDAGFDIEQLLYSPQ
SYSASTAPNRGVCFLVARKKPGS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggcttcacggggggtgatgagtaccagaagcacttcctgcccagggactac
ctgaacacctactacagcttccagagcggcccctcgcctgaggcggagatgctcaaattt
aacctggagtgtttgcacaagaccttcggccctggcggcctccaaggggacacactgatt
gacatcggctcgggccccaccatctatcaagtcctcgctgcctgcgagtccttcaaagac
atcactctctccgacttcactgaccgcaaccgggaggagctggccaagtggctgaagaag
gagcctggggcctatgactggactccggcgctgaagttcgcctgtgagctagaagggaac
agtggccggtggcaggagaaggcggagaagctgcgtgccaccgtgaagcgggtgctcaag
tgtgatgccaacctgagcaacccgctgacccctgtggtgctgccgcccgccgactgcgtg
ctcaccctactggccatggagtgcgcctgctgcagcctggacgcctaccgggcggcgctg
cgcaacctggcctcgctgctgaagccgggcggccacctggtgaccactgtgacgctgcag
ctgtcctcctacatggtgggtgagcgggagttctcctgcgtggccctggagaaggaggag
gtggagcaggccgtcctggatgctggctttgacattgagcagctgctgtacagcccccag
agctactcggccagcaccgcccccaacagaggggtgtgcttccttgtggcccgcaagaag
ccggggtcctga

DBGET integrated database retrieval system