KEGG   Oryctolagus cuniculus (rabbit): 100008911Help
Entry
100008911         CDS       T03373                                 

Gene name
INSR, DAF-2
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04520  Adherens junction
ocu04910  Insulin signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04923  Regulation of lipolysis in adipocytes
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease (NAFLD)
ocu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100008911 (INSR)
   04015 Rap1 signaling pathway
    100008911 (INSR)
   04010 MAPK signaling pathway
    100008911 (INSR)
   04066 HIF-1 signaling pathway
    100008911 (INSR)
   04068 FoxO signaling pathway
    100008911 (INSR)
   04072 Phospholipase D signaling pathway
    100008911 (INSR)
   04022 cGMP - PKG signaling pathway
    100008911 (INSR)
   04151 PI3K-Akt signaling pathway
    100008911 (INSR)
   04152 AMPK signaling pathway
    100008911 (INSR)
   04150 mTOR signaling pathway
    100008911 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100008911 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100008911 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100008911 (INSR)
   04913 Ovarian Steroidogenesis
    100008911 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100008911 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    100008911 (INSR)
   04213 Longevity regulating pathway - multiple species
    100008911 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100008911 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100008911 (INSR)
   04931 Insulin resistance
    100008911 (INSR)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100008911 (INSR)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100008911 (INSR)
CD molecules [BR:ocu04090]
 Proteins
  100008911 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 100008911
NCBI-ProteinID: XP_008247399
Ensembl: ENSOCUG00000004436
Position
Un
AA seq 1381 aa AA seqDB search
MGAGGRRGAVAAPLLAAVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKEVGLHSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCTVCRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLDGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTISQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSSIRTTFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKAQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQILLKWKPPSDPNGNITHYLVFWE
RQEEDRELYELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGSGAENTRPSRKRRSLGEVNNVTAAAPTVPGF
SNTTSTSVPVSPEVHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKDPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVSLLKDDLHPSFPEVSFFHSEENKAPESEDLEME
FEDMESVPLDRSAHCQREEAGGREGVSSLGVKRYEDHIPYTHMNGGKKNGRILSLPRANP
S
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctgggggccggcggggggcggtggccgcgccgctgctggcggcggtggccgcg
ctgctggtgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcaccagactgcatgagctggagaactgctctgtcatcgagggccacctg
cagatcctcctgatgttcaagacgaggcctgaggacttccgggacctcagcttccccaag
ctcatcatgatcaccgactacctgctgctgttccgggtctacgggctggagagcctcaag
gacctgttccccaacctcacggtcatccggggctccaggctgttcttcaactatgcgctg
gtcatcttcgagatggtgcacctgaaggaggttgggctacacagcctcatgaacatcacc
cggggctccgtgcgcatcgagaagaacaatgaactctgctacttggccaccatagactgg
tcccggatcctggactcagtggaggacaactacattgtgctgaacaaggacgacaacgag
gagtgcggggacatctgtccaggcaccgcaaagggcaagaccaactgtcctgccactgtc
atcaatgggcagtttgtcgagcggtgctggactcacagccactgccagaaagtgtgcccg
accatctgtaagtcgcacggctgcaccgccgagggcctctgctgccacagcgagtgcttg
ggcaactgttccgagcccgacgaccccaccaagtgcaccgtgtgccggaacttctacctg
gatggccggtgcgtggagacctgcccgcccccctactaccacttccaggactggcgctgc
gtgaacttcagcttctgccaggacctgcacaacaagtgcaagaactcgcgcaggcagggc
tgccaccagtacgtcatccacaacaacaagtgcatccccgagtgcccctcggggtacacg
atgaactccagcaacttgatgtgcaccccgtgcctgggcccctgtcccaaggtgtgccac
ctgctagatggtgagaagaccatcgactcggtgacgtctgcccaggagctccgaggctgc
accgtcatcaacggcagcctgatcatcaacatccgaggaggcaataacctggcggctgag
ctcgaggccaacctcggcctcattgaagagatttcagggtacctgaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggggagaccttg
gagattggaaactactccttctacgccttggacaaccagaacctgaggcagctctgggac
tggagcaaacacaacctcaccatctctcaggggaagctcttcttccactacaaccccaaa
ctctgcttgtcagagattcacaagatggaagaagtctccggaaccaaggggcgccaggag
aggaacgacatcgccctgaaaaccaacggggaccaggcttcctgtgaaaacgagctgctt
aagttttcttccattcggacaacgttcgacaagatcttgctgagatgggagccctactgg
ccccccgacttccgagacctcttggggttcatgcttttttacaaagaggccccctatcag
aacgtgacggagttcgatgggcaggacgcgtgtggctccaacagctggaccgtggtagac
atcgacccgcccctgagatccaatgaccccaaggctcagaaccaccctgggtggctgatg
cgcggcctcaagccctggacccagtatgccatcttcgtgaagacattggtcaccttctct
gatgagcgccggacctatggagccaagagtgacatcatttatgtccagacggacgctacc
aatccttctgtccccctggatccgatttcggtttctaactcctcctcccagattcttttg
aagtggaaacctccctcggaccccaatggcaacatcacgcactacctggttttctgggag
agacaggaggaggacagagagctctacgagttggattattgcctcaaagggttgaagctg
ccctcccgcacgtggtcacccccattcgaatccgacgattcgcagaagcacaaccagagt
gaatatgaggactcggcgggcgagtgctgctcctgccccaagaccgactcccagatcctg
aaggagctggaggagtcttccttccgcaagactttcgaggactacctgcacaacgtggtc
ttcgtgcccagaaaaacctcttcaggctctggtgccgagaacactaggccgtcgaggaaa
cgcaggtcccttggtgaggtcaacaatgtgacagcggctgcacccacagtcccaggattc
tccaacacgacgtccaccagcgtgcccgtgagcccagaggtgcacaggcccttcgagaag
gtggtgaacaaagagtcactggtcatctccggcctgcgccacttcaccggctaccgcatc
gagctgcaggcctgcaaccaggacacgcccgaggagaggtgcagcgtggctgcctacgtc
agtgcacggaccatgcctgaagccaaggctgatgacatcgtcggccccgtgacgcatgag
atcttcgagaacaacgtggtccatttgatgtggcaagagccgaaggaccccaacggtctg
atcgtcctgtacgaagtgagctatcggagatatggtgatgaggagctgcacctctgcgtc
tcccgcaagcactttgccctggagcggggctgcaggctgcgggggctttcccccggaaac
tacagcgtgcgggtgcgggccacctccctggcaggcaatggctcctggacggaagccacc
tatttctacgtgacagactacctagatgtcccatcgaatattgcaaaaatcatcatcggc
cccctcatcttcgtcttcctcttcagtgtggtgattggaagtatttatctattcctgaga
aagaggcagccggatgggccactgggaccgctgtacgcttcctcaaaccccgagtacctc
agcgccagtgatgtgtttccctgttctgtgtacgttccggatgaatgggaggtgcctcgg
gagaagatcaccctcctgcgggagctgggccagggctcctttggcatggtgtatgagggc
aacgccaaggacatcatcaagggggaggccgagacccgcgtggctgtgaagactgtcaat
gagtcggccagtctccgggagcggattgagttcctcaatgaggcctccgtcatgaagggc
ttcacctgccatcatgtggtccgcctcctgggggtggtgtccaagggccagcccacgctg
gtggtgatggagttgatggctcacggagacttgaagagctaccttcgttctctgcggccc
gaggctgagaacaacccgggtcgccctccccctaccctccaagagatgatacagatggcg
gcggagatcgcggacggcatggcgtacctgaacgccaagaagtttgtgcaccgggacctg
gcagcccgaaactgcatggttgcccacgattttaccgtcaaaatcggagatttcggaatg
accagagacatctacgaaacggattactaccggaaggggggcaagggtctgctgcctgtg
cgatggatggcgccagagtccctgaaggacggggttttcaccacctcttctgacatgtgg
tcgtttggcgtggtcctctgggaaatcaccagcttggcggagcagccttaccaaggcctg
tccaatgagcaggtgttgaagtttgtcatggacggagggtacctggaccaacccgacaac
tgtccagagagagtcaccgacctgatgcgcatgtgctggcagttcaaccccaagatgcgg
cccactttcctggagatcgtcagcctgctgaaggacgacctccaccccagctttccggaa
gtttccttcttccacagcgaggagaacaaggctcccgagagcgaggacctggagatggaa
ttcgaggacatggagagcgtgccactggaccggtccgcgcactgtcagagagaggaggca
gggggccgggaaggggtgtcctcgctgggcgtcaagcgctatgaagaccacatcccctac
acccacatgaacgggggcaagaaaaacgggcggattctgagcctgcctcgggcgaatccc
tcctaa

DBGET integrated database retrieval system