KEGG   Oryctolagus cuniculus (rabbit): 100008972Help
Entry
100008972         CDS       T03373                                 

Gene name
PYGM
Definition
(RefSeq) glycogen phosphorylase, muscle associated
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00500  Starch and sucrose metabolism
ocu01100  Metabolic pathways
ocu04217  Necroptosis
ocu04910  Insulin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04931  Insulin resistance
Module
ocu_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100008972 (PYGM)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100008972 (PYGM)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100008972 (PYGM)
   04922 Glucagon signaling pathway
    100008972 (PYGM)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100008972 (PYGM)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     100008972 (PYGM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase TPR_22 COX_ARM
Motif
Other DBs
NCBI-GeneID: 100008972
NCBI-ProteinID: NP_001075653
Ensembl: ENSOCUG00000002173
UniProt: P00489
Structure
PDB: 
2GJ4 5LRF 1H5U 1C8K 5MEM 1A8I 5OX4 5LRD 5LRE 4YI3 4YI5 2QRQ 2QNB 1WW3 1K06 3ZCP 3ZCV 2QRH 2QN7 1XC7 5OWZ 5OX1 5JTT 5JTU 4MI9 2QRG 3L79 2QRP 2PYI 6F3L 6F3R 6F3S 5OWY 5OX0 5OX3 5O50 5O52 4CTO 4MI6 3L7A 3EBO 3BD7 2QRM 2QN8 2IEG 1Z62 1WW2 1GPB 2IEI 1XL0 3L7C 3CUV 2PYD 2F3U 1XKX 3MRV 2F3P 1P2D 5MCB 4CTM 3MTB 3MRX 3MS7 3MSC 3MQF 2QN3 2F3Q 2F3S 3NPA 1KTI 3MRT 2GPN 5LRC 4YUA 4MHO 4MHS 3ZCT 4EL5 3S0J 3NP9 3MT7 3MT8 3L7B 3L7D 3G2I 3G2K 3EBP 3CUW 3BD6 3BDA 3BCS 2QN9 1P4J 1LWN 1LWO 2GPA 1B4D 3ZCS 3G2H 3BCU 2FFR 2FF5 2FET 1Z6Q 3ZCU 3NP7 3MT9 1P4H 3ZCR 3NC4 3MS4 2G9R 4Z5X 4CTN 3MTD 3MS2 3G2N 3BD8 2QLM 1XL1 1P4G 3AMV 3G2J 3BCR 4MI3 3ZCQ 3T3E 2QLN 2G9U 2G9V 6F3J 6F3U 2OFF 1P29 1P2B 8GPB 3MTA 1E1Y 1WV0 1WV1 1WUY 1WUT 1K08 1HLF 3G2L 3CUT 3CUU 2GM9 1UZU 1P2G 1GFZ 1C8L 2PRJ 1C50 1BX3 2PRI 2AMV 1AXR 2GPB 3GPB 4GPB 5GPB 1GG8 4MRA 6QA8 1FU8 1FTQ 6QA7 1FU4 1FU7 1FTW 1GGN 1FTY 1FS4 6R0I 6QA6 4EL0 3T3G 3SYM 3SYR 2QN1 1Z6P 2SKC 2SKD 1NOJ 1NOK 1GPY 5O54 5O56 4MIC 4EKY 2SKE 6R0H 3T3D 2G9Q 1NOI 3E3L 4EKE 3T3H 3E3O 4EJ2 3T3I 3E3N 2QN2 1ABB 6GPB 1PYG 9GPB 1GPA 7GPB
Thumbnails

Position
Un
AA seq 843 aa AA seqDB search
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKICGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERL
DWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQ
ENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVV
PRTVMIGGKPAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD
RLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEE
YVKCQERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
KIP
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcccctgtcagaccaggagaagagaaagcaaatcagcgtgcgcggcctggcc
ggcgtggagaatgtgacggagctgaaaaaaaacttcaaccgccacctgcatttcaccctg
gtgaaggaccgcaatgtggccacgccgcgagactactacttcgcactggcccacactgtg
cgcgaccacctcgtggggcgctggatccgcacgcagcaacactactatgagaaggacccc
aagaggatctactacctgtctttggagttctacatgggccggacgctacagaacaccatg
gtgaacctggctttggagaatgcctgcgacgaggccacctaccagctgggcctggacatg
gaggagctggaggaaatcgaggaggacgccgggctgggcaacggcggcctgggccggctg
gcagcctgttttctggactccatggcaacactcggcctggctgcctatggctacgggatc
cgctatgagtttgggatctttaaccagaagatctgcgggggctggcagatggaagaggct
gatgactggcttcgctacggcaacccctgggagaaggcccggcctgagttcacactgcct
gtgcacttctatggccgagtggagcacaccagccagggggccaagtgggtggacacacag
gtggtgctggccatgccctacgacacaccggtgcctggctaccgcaacaacgtcgtcaac
accatgcgcctctggtcggccaaggcgcccaatgacttcaacctcaaggacttcaacgtc
ggtggctacatccaggccgtgctggaccgcaacctggctgagaacatctctcgggtcctg
taccccaacgataacttcttcgaggggaaggagctgcggctgaagcaggagtacttcgtg
gtggcggccaccctgcaggacatcatccgccgcttcaagtcctccaaattcggctgccgc
gaccccgtgcgcaccaacttcgatgccttcccggataaggtagccatccagctcaatgac
acccacccctcgctggccatccccgagctcatgagggtgctggtggacctggagcggctg
gactgggacaaggcctgggaagtgacggtaaagacgtgcgcctacaccaaccacacggtg
ctgcccgaggcgctggagcgctggcccgtgcacctcctggagacgctgctgccgcgccac
ctccagatcatctacgagatcaaccagcgcttcctgaaccgcgtggcggctgcgttcccg
ggggacgtcgaccggctgcggcgcatgtcgctggtggaggagggcgccgtgaaacgcatc
aacatggcgcacctgtgcatcgcgggctcgcacgccgtcaacggtgtggctcgcatccac
tcggagatcctcaagaagaccatcttcaaggacttctacgagctggagcctcataagttc
cagaacaagaccaacggcatcacccctcggcgctggctggttctgtgtaaccctgggctg
gccgagatcattgctgagcgcatcggggaggagtacatctcagacctggaccagctgcgc
aagctgctctcgtatgtggacgacgaagccttcatccgggatgtggcgaaagtgaagcag
gaaaacaagctgaagttcgcggcctacctggagagggaatacaaggtccacatcaacccc
aactcgctgttcgacgtccaagtgaaacggatccatgaatacaagcggcagctgctcaac
tgcctgcacgtcatcaccctgtacaaccgcatcaagaaggagcccaataagtttgttgtg
cctcggaccgtcatgattggagggaagcccgcacctgggtaccacatggccaagatgatc
atcaaacttatcaccgccattggggatgtggtcaaccacgacccggtggttggagaccgc
ctccgtgtcatcttcctggagaactaccgggtctcactggctgagaaagtgatcccggct
gccgacctctcggagcagatctccaccgcgggcaccgaggcctccggcaccggcaacatg
aagttcatgctcaatggagccctgaccattggcacgatggacggcgccaacgtggagatg
gccgaggaggcgggagaggagaacttcttcatctttggcatgcgggtggaagatgtggac
agactcgaccagagagggtacaacgcccaggagtactacgaccgcatcccggagcttcgg
cagatcatcgagcagctgagtagcggcttcttctccccgaagcagccggacctgttcaag
gacattgtcaacatgctcatgcaccatgaccggttcaaagtctttgcagattatgaagag
tacgtcaagtgccaggagcgagtcagcgccttgtacaagaaccccagagagtggacgcgg
atggtgatccggaacatagccacctcgggcaagttctccagcgaccgcaccattgcccag
tacgcgcgggagatctggggtgtggagccctcgcggcagcggctgccagcccccgacgag
aagataccctag

DBGET integrated database retrieval system