KEGG   Oryctolagus cuniculus (rabbit): 100008974Help
Entry
100008974         CDS       T03373                                 

Gene name
NAT2, NAT-2
Definition
(RefSeq) N-acetyltransferase 2 (arylamine N-acetyltransferase)
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00232  Caffeine metabolism
ocu00983  Drug metabolism - other enzymes
ocu01100  Metabolic pathways
ocu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100008974 (NAT2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100008974 (NAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100008974 (NAT2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100008974 (NAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 100008974
NCBI-ProteinID: NP_001075655
UniProt: P11246
AA seq 290 aa AA seqDB search
MDIEAYYQRIGYKNPRNKLDLESLTDIFQHQIRTVPYENLSIHCGESMELDLEAIFDQIV
RRNRGGWCLQVNYLLYWALTTTGFETTMLGGFVYGSNNDKYSTGMIHLIVQVTINGRNYI
VDAGFGRSYQMWQPVELISGKDQPQVPSIFRLREEGETWYLDQIRRQQHVPDQEFLNSEL
LEKKIYQKLYCFTLQPRTIEEFESANTYLQESPSSVFLDKSICSLQTPEGVHCLVGLTLT
SRTYNYKENTDLVEFKVLTEEEVEGVLKTIFNISLGKKLVSKNGHLSFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggatattgaagcatattatcaaagaattggttacaaaaacccaaggaacaaattggac
ttggaatcactaacagacatttttcagcaccagatccgaactgttccctatgagaacctt
agcattcactgtggggagtccatggagttggacttagaggccatttttgatcaaattgtg
aggaggaatagaggtggctggtgtctccaggtcaactatcttttgtactgggctttgact
accaccggttttgagaccacaatgttaggagggtttgtttatggcagtaataatgacaaa
tacagcactggcatgattcacctcatagtacaggtgaccatcaatggcaggaactacatt
gtcgatgctgggtttggacgctcctaccagatgtggcagcctgtggagttaatttctggg
aaagatcagcctcaagtgccttccatattccgcttgagagaagagggagaaacctggtac
ctggaccaaatcagaagacagcaacatgttccagaccaagaatttcttaattctgaactc
ctggaaaagaaaatataccaaaaactctactgctttactcttcaacctcgaacaattgaa
gaatttgagtctgcaaacacatatcttcaagaatccccatcatctgtgtttttagacaaa
tcaatttgttccttgcagaccccagaaggtgttcactgtttggtgggcctcaccctcacc
tccaggacctacaattataaggaaaatacagatctggtagagtttaaagttctgactgag
gaagaagtggagggagtgctgaaaactatatttaatatttccttgggaaaaaagcttgtg
tccaaaaatggtcatttgtctttcactatttag

DBGET integrated database retrieval system