KEGG   Oryctolagus cuniculus (rabbit): 100009008
Entry
100009008         CDS       T03373                                 

Gene name
NEDD8
Definition
(RefSeq) neural precursor cell expressed, developmentally down-regulated 8
  KO
K12158  ubiquitin-like protein Nedd8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100009008 (NEDD8)
Ubiquitin system [BR:ocu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100009008 (NEDD8)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2
Other DBs
NCBI-GeneID: 100009008
NCBI-ProteinID: NP_001075681
Ensembl: ENSOCUG00000002910
UniProt: Q4PLJ0
Position
17
AA seq 81 aa
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLRQ
NT seq 246 nt   +upstreamnt  +downstreamnt
atgctaattaaagtgaagacgctgactggaaaggagattgaaattgacattgaacccaca
gacaaggtggagcgaatcaaggagcgtgtggaggagaaagagggcatccccccccaacag
cagcggctcatctacagtggcaaacagatgaatgatgagaagacagcagcagattacaag
atccttggtgggtcagtcctccacctggtgttggctctgagaggaggaggtggtcttagg
cagtga

DBGET integrated database retrieval system