KEGG   Oryctolagus cuniculus (rabbit): 100009055
Entry
100009055         CDS       T03373                                 

Gene name
ALDOA
Definition
(RefSeq) aldolase, fructose-bisphosphate A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00010  Glycolysis / Gluconeogenesis
ocu00030  Pentose phosphate pathway
ocu00051  Fructose and mannose metabolism
ocu01100  Metabolic pathways
ocu01200  Carbon metabolism
ocu01230  Biosynthesis of amino acids
ocu04066  HIF-1 signaling pathway
Module
ocu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ocu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100009055 (ALDOA)
   00030 Pentose phosphate pathway
    100009055 (ALDOA)
   00051 Fructose and mannose metabolism
    100009055 (ALDOA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100009055 (ALDOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009055 (ALDOA)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009055 (ALDOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009055 (ALDOA)
Enzymes [BR:ocu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     100009055 (ALDOA)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100009055 (ALDOA)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100009055 (ALDOA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100009055 (ALDOA)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 100009055
NCBI-ProteinID: NP_001075707
Ensembl: ENSOCUG00000006329
UniProt: P00883
Structure
PDB: 

Position
6
AA seq 364 aa
MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFIS
NHAY
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcctcactcccatccagcgctgaccccggagcagaagaaggagctgtccgacatcgcc
caccgcattgtggctccgggcaagggcatcctggctgcagatgagtccaccgggagcatt
gccaagaggctgcagtccatcggcaccgagaacacggaagagaaccggcgtttctaccgg
cagctgctgctgaccgcggatgaccgcgtgaacccttgcatcgggggcgtcatcctcttc
cacgagaccctctaccagaaggcggacgatgggcgtcccttcccgcaagttatcaagtcc
aagggcggtgttgtgggcatcaaggtagacaagggcgtggtacctctggcaggaactaat
ggcgagaccaccacccaagggttggatgggctgtccgagcgctgtgcccagtacaagaaa
gatggagccgacttcgccaagtggcgttgcgtgctgaagattggggaacacaccccctca
gccctcgccatcatggagaatgccaacgtcctggcccgttacgccagcatctgccagcag
aatggcattgtgcccattgtggagcccgaaatcctccccgatggggaccacgacctgaag
cgctgccagtatgtcactgagaaggtgctggccgccgtctacaaggctctgagtgatcac
cacatctacctggaaggcaccttgctgaagcccaacatggtaacccctggccatgcctgc
acccagaagtattctcacgaggagattgccatggcaaccgtcacagcgctgcgccgcaca
gtgccccccgctgtcactggagttaccttcctgtctggaggtcagagtgaggaggaggca
tccatcaacctcaacgccatcaacaagtgccccctgctgaagccgtgggccctgaccttc
tcctacggccgtgccctgcaggcctcagctctgaaggcctggggtgggaagaaggagaac
ctgaaggctgcccaggaggagtacgtgaagcgggccctggccaacagcctcgcctgccaa
gggaagtacaccccgagtggtcaggccggggccgcggccagcgagtccctcttcatctct
aaccacgcctactaa

DBGET integrated database retrieval system