KEGG   Oryctolagus cuniculus (rabbit): 100009074
Entry
100009074         CDS       T03373                                 

Gene name
GAPDH
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00010  Glycolysis / Gluconeogenesis
ocu01100  Metabolic pathways
ocu01200  Carbon metabolism
ocu01230  Biosynthesis of amino acids
ocu04066  HIF-1 signaling pathway
ocu05010  Alzheimer disease
ocu05132  Salmonella infection
ocu05415  Diabetic cardiomyopathy
Module
ocu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ocu_M00002  Glycolysis, core module involving three-carbon compounds
ocu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100009074 (GAPDH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100009074 (GAPDH)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009074 (GAPDH)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009074 (GAPDH)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100009074 (GAPDH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009074 (GAPDH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009074 (GAPDH)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     100009074 (GAPDH)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100009074 (GAPDH)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100009074 (GAPDH)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N LptD_N
Other DBs
NCBI-GeneID: 100009074
NCBI-ProteinID: NP_001075722
UniProt: P46406
Structure
PDB: 
1J0X

Position
8
AA seq 333 aa
MVKVGVNGFGRIGRLVTRAAFNSGKVDVVAINDPFIDLHYMVYMFQYDSTHGKFHGTVKA
ENGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIIS
APSXDAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSATHSSTFDAGAGIA
LNDHFVKLISWYDNEFGYSNRVVDLMVHMASKE
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggtgaaggtcggagtgaacggatttggccgcattgggcgcctggtcaccagggctgct
tttaactctggcaaagtggatgttgtcgccatcaatgatccattcattgacctccactac
atggtctacatgttccagtatgattccacccacggcaagttccacggcacggtcaaggct
gagaacgggaagctggtcatcaacgggaaggccatcaccatcttccaggagcgagatccc
gccaacatcaagtggggtgatgctggtgccgagtacgtggtggaatccactggcgtcttc
accaccatggagaaggccggggctcatttgaagggcggagccaaaagggtcatcatctca
gccccctcckccgatgcccccatgtttgtgatgggcgtgaaccacgagaagtatgacaac
tctctcaagattgtcagcaacgcatcctgcaccaccaactgcttagcccccctggccaag
gtcatccacgaccacttcggcattgtggaggggctcatgaccacggtgcacgccatcact
gccacccagaagaccgtggacgggccctctgggaagctgtggcgtgacggccgcggggcc
gcccagaacatcatccctgcctccactggcgctgccaaggccgtgggcaaggtcatcccc
gagctgaacgggaaactcactggcatggccttccgtgtgcccacccccaacgtgtcggtc
gtggacctgacctgccgcctggagaaagctgctaagtatgacgacatcaagaaggtggtg
aagcaggcatccgagggccccctgaagggcatcctgggctacaccgaggaccaggtcgtc
tcctgcgacttcaacagtgccacccactcctctaccttcgatgctggggctggcattgcc
ctcaatgaccactttgtgaagctcatttcctggtatgacaacgaatttggctacagcaac
agggtggtggacctcatggtccacatggcctccaaggagtaa

DBGET integrated database retrieval system