KEGG   Oryctolagus cuniculus (rabbit): 100009093Help
Entry
100009093         CDS       T03373                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00052  Galactose metabolism
ocu00500  Starch and sucrose metabolism
ocu01100  Metabolic pathways
ocu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100009093 (SI)
   00500 Starch and sucrose metabolism
    100009093 (SI)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100009093 (SI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009093 (SI)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     100009093 (SI)
    3.2.1.48  sucrose alpha-glucosidase
     100009093 (SI)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100009093 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100009093
NCBI-ProteinID: NP_001075735
Ensembl: ENSOCUG00000003878
UniProt: P07768
Position
14
AA seq 1827 aa AA seqDB search
MAKRKFSGLEITLIVLFVIVFIIAIALIAVLATKTPAVEEVNPSSSTPTTTSTTTSTSGS
VSCPSELNEVVNERINCIPEQSPTQAICAQRNCCWRPWNNSDIPWCFFVDNHGYNVEGMT
TTSTGLEARLNRKSTPTLFGNDINNVLLTTESQTANRLRFKLTDPNNKRYEVPHQFVTEF
AGPAATETLYDVQVTENPFSIKVIRKSNNRILFDSSIGPLVYSDQYLQISTRLPSEYMYG
FGEHVHKRFRHDLYWKTWPIFTRDQHTDDNNNNLYGHQTFFMCIEDTTGKSFGVFLMNSN
AMEIFIQPTPIVTYRVIGGILDFYIFLGDTPEQVVQQYQELIGRPAMPAYWSLGFQLSRW
NYNSLDVVKEVVRRNREALIPFDTQVSDIDYMEDKKDFTYDRVAYNGLPDFVQDLHDHGQ
KYVIILDPAISINRRASGEAYESYDRGNAQNVWVNESDGTTPIVGEVWPGDTVYPDFTSP
NCIEWWANECNIFHQEVNYDGLWIDMNEVSSFVQGSNKGCNDNTLNYPPYIPDIVDKLMY
SKTLCMDSVQYWGKQYDVHSLYGYSMAIATERAVERVFPNKRSFILTRSTFAGSGRHAAH
WLGDNTATWEQMEWSITGMLEFGLFGMPLVGADICGFLAETTEELCRRWMQLGAFYPFSR
NHNADGFEHQDPAFFGQDSLLVKSSRHYLNIRYTLLPFLYTLFYKAHAFGETVARPVLHE
FYEDTNSWVEDREFLWGPALLITPVLTQGAETVSAYIPDAVWYDYETGAKRPWRKQRVEM
SLPADKIGLHLRGGYIIPIQQPAVTTTASRMNPLGLIIALNDDNTAVGDFFWDDGETKDT
VQNDNYILYTFAVSNNNLNITCTHELYSEGTTLAFQTIKILGVTETVTQVTVAENNQSMS
THSNFTYDPSNQVLLIENLNFNLGRNFRVQWDQTFLESEKITCYPDADIATQEKCTQRGC
IWDTNTVNPRAPECYFPKTDNPYSVSSTQYSPTGITADLQLNPTRTRITLPSEPITNLRV
EVKYHKNDMVQFKIFDPQNKRYEVPVPLDIPATPTSTQENRLYDVEIKENPFGIQIRRRS
TGKVIWDSCLPGFAFNDQFIQISTRLPSEYIYGFGEAEHTAFKRDLNWHTWGMFTRDQPP
GYKLNSYGFHPYYMALEDEGNAHGVLLLNSNAMDVTFMPTPALTYRVIGGILDFYMFLGP
TPEVATQQYHEVIGHPVMPPYWSLGFQLCRYGYRNTSEIIELYEGMVAADIPYDVQYTDI
DYMERQLDFTIDENFRELPQFVDRIRGEGMRYIIILDPAISGNETRPYPAFDRGEAKDVF
VKWPNTSDICWAKVWPDLPNITIDESLTEDEAVNASRAHAAFPDFFRNSTAEWWTREILD
FYNNYMKFDGLWIDMNEPSSFVNGTTTNVCRNTELNYPPYFPELTKRTDGLHFRTMCMET
EHILSDGSSVLHYDVHNLYGWSQAKPTYDALQKTTGKRGIVISRSTYPTAGRWAGHWLGD
NYARWDNMDKSIIGMMEFSLFGISYTGADICGFFNDSEYHLCTRWTQLGAFYPFARNHNI
QFTRRQDPVSWNQTFVEMTRNVLNIRYTLLPYFYTQLHEIHAHGGTVIRPLMHEFFDDRT
TWDIFLQFLWGPAFMVTPVLEPYTTVVRGYVPNARWFDYHTGEDIGIRGQVQDLTLLMNA
INLHVRGGHILPCQEPARTTFLSRQKYMKLIVAADDNHMAQGSLFWDDGDTIDTYERDLY
LSVQFNLNKTTLTSTLLKTGYINKTEIRLGYVHVWGIGNTLINEVNLMYNEINYPLIFNQ
TQAQEILNIDLTAHEVTLDDPIEISWS
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaggaaattttctggcttagaaatcactctgattgtcctctttgtgatagtt
tttataatagctattgctctaattgctgtgttagcaactaagacaccagcagttgaagag
gttaatccttccagttcaactccaactacgacttcaactacaacttcaacttccggttca
gtaagctgtcccagtgagctaaatgaggttgtcaatgagagaataaactgcattccagaa
caatctccaacacaggcgatttgtgcacaacgaaactgctgttggagaccatggaacaac
tcagatatcccatggtgcttctttgtagacaatcatggctacaatgttgaaggaatgaca
acaacaagtactggacttgaagccaggttaaacaggaaatcaacacctacactttttgga
aatgatattaacaatgtcctcctcaccactgaaagtcagacagccaatcgtttacggttc
aagcttactgatccaaataataaaagatatgaagttcctcatcaatttgtgacagaattt
gctggacctgcagctactgagacattatatgatgtacaggttacagaaaatccttttagc
atcaaagttatcaggaaaagtaacaacaggattttgtttgacagcagcattggtcccctg
gtgtactctgaccagtatttacagatctcaaccagacttcccagtgagtacatgtatggt
tttggagaacatgttcacaagagatttcgtcatgatttatattggaaaacatggccgatc
tttactcgggatcaacatactgatgataataataataatttatatggccatcagacattc
ttcatgtgtattgaagacactactggaaagtcatttggtgtttttttaatgaacagcaat
gcaatggaaattttcatccagcctactccaatagtaacctatagagttatcggtggcatc
ctagacttttacatctttttaggagatacaccagaacaggtggtccaacagtatcaagag
ctcattggacgaccagcaatgccagcatactggagtcttggattccaactgagtcgctgg
aattacaattctctagatgtagtcaaagaggtggtaagaagaaacagggaagctctcata
ccatttgatacacaagtcagtgatattgactatatggaagacaagaaagacttcacttat
gatagagtggcatataatgggctccctgactttgttcaagatttgcatgaccatggacag
aaatatgttattatcttggaccctgcaatttctataaataggcgtgccagtggagaagca
tatgaatcctatgacagaggaaatgcacaaaatgtgtgggtaaatgagtcagatggaact
acaccaatagttggagaggtctggccaggagatacagtatatcctgatttcaccagtcca
aactgcatagaatggtgggcaaatgaatgcaatattttccatcaagaagtgaattatgat
ggactttggattgacatgaatgaagtgtccagctttgttcaaggctcaaataagggctgt
aatgacaacacattgaattatccaccttacattcctgatattgttgataagctcatgtat
tccaaaacactttgcatggattctgtgcagtactggggaaaacagtatgatgttcacagc
ctatatggatatagcatggctatagccactgaaagagctgtagaaagagttttccctaac
aagagaagcttcatccttactcggtcaacttttgctggaagtggaagacatgctgcacat
tggctaggagataacacggctacttgggaacaaatggagtggtctatcactgggatgcta
gagttcggtttgtttggaatgcctttggttggtgcagatatctgtggatttctggctgaa
accacagaagagctttgcagaaggtggatgcaacttggggccttttatccgttttccaga
aatcataatgctgatggatttgagcatcaggatcccgcattttttggacaagactcactt
ttggttaagtcatctcggcactacttaaatatccgctataccttattgcctttcctctat
actctattttacaaagcccatgcgtttggagaaacagtagcaaggccagttcttcatgag
ttttatgaggacacaaacagctgggttgaggacagagagtttttatggggccccgcttta
ctcattactcctgttttgacacagggagcagagacagtgagtgcatacattcctgatgct
gtttggtatgattatgaaacaggtgcaaaaaggccatggagaaagcaacgggtggaaatg
agtcttccagcagacaaaataggactgcatcttagaggaggttacattatccccattcaa
caacctgctgtaacaacaacagcaagtcgtatgaatcctctaggacttataattgcatta
aatgatgataacacagcagtaggagactttttctgggatgatggagaaactaaagatacc
gtacaaaatgacaactacatattatatacatttgcagtttctaacaacaatttaaatatc
acatgcacacatgaattatactcagaaggaacaactttagcatttcagactataaaaatt
ctcggggtgacggagaccgttacacaggttacagtggcagaaaataatcagtcaatgagt
acgcactctaatttcacatatgatccctccaaccaggttctcttaattgagaatctcaac
tttaaccttggaagaaacttcagagttcaatgggatcaaactttcttagaaagcgaaaag
attacttgttatccagatgcagacattgcaactcaggaaaagtgcactcaacgtggatgt
atatgggacacgaatactgtgaaccctcgagcacctgaatgttacttccctaaaactgac
aacccttattcagttagctcaactcagtattcaccgacgggtataacagctgacctccag
ttgaatcctacaagaaccagaataactttaccttctgaacccattacaaatcttcgtgtg
gaggtgaaatatcacaaaaatgatatggtacagtttaagatttttgatccccaaaacaag
agatatgaagttccggtaccactagacattccagccactccaacaagcacacaggaaaac
agactttatgatgttgaaatcaaggaaaacccttttggtatccagattcgacggagaagc
actggaaaagttatttgggattcttgtctacctggttttgcttttaatgatcagttcatt
caaatatctactcgcctgccatcggaatatatatatggttttggagaagcagaacacaca
gcatttaagagagatctgaactggcatacttgggggatgttcacaagagaccaaccccct
ggttacaaacttaattcctatggatttcatccttattacatggctctggaagatgaagga
aatgcccatggagttttgttactgaacagcaatgcaatggatgttacattcatgccaact
ccagctctaacttatcgtgtaattggaggaatcttggatttttatatgttcttaggccca
actccagaagttgcaacccaacaatatcatgaagtaattggccatccagtcatgccaccg
tattggtctttaggattccaattatgtcggtatggatacagaaatacttcagagattatt
gaactatatgaggggatggtggctgctgacataccctatgatgttcaatacacagatatt
gattacatggaaaggcaactagactttacaattgatgaaaactttcgtgaacttcctcaa
tttgttgatagaataagaggagaaggaatgagatacattattattctggacccagcaatt
tcaggaaatgaaacacggccttaccctgcatttgacagaggggaagctaaagatgtcttc
gtcaaatggcctaataccagtgatatttgttgggcaaaggtttggccagacttgcctaat
ataacaatagatgaaagtctaactgaagatgaagctgttaacgcttcccgagctcacgca
gcttttccagatttcttcaggaattccacagcagagtggtggacaagagaaattttagat
ttctacaataactatatgaagtttgatggcttgtggattgatatgaatgaaccatcaagt
tttgtgaatggaacaactactaatgtatgcagaaatacagagctaaattatccaccttat
ttcccagaacttacaaaacggacagatggattgcatttcagaactatgtgcatggaaact
gagcatattcttagtgatggatcatcagttttacattatgatgttcacaatctctatgga
tggtcacaagcaaagcctacttatgatgccttgcagaagacaactggcaaaagagggata
gttatttctcgttctacatatcctactgctgggcgatgggcaggacactggcttggagac
aactatgcacggtgggacaatatggacaaatcgatcattggtatgatggaatttagtctc
tttggaatatcatatactggagcagacatctgtggtttcttcaatgattcagaatatcat
ctctgtactcgctggacacaacttggagcattttatccatttgcaagaaatcacaacatt
caatttactagaagacaagaccctgtttcatggaatcaaacttttgttgaaatgacaagg
aatgttctgaatattagatatactttattaccttatttctatacacaattgcatgaaatt
catgctcatggtggcactgttatccgaccccttatgcatgagttctttgatgacagaaca
acttgggacatatttctacagtttctgtggggtccagcatttatggttacccctgtgttg
gaaccttatactactgttgtacgtggctatgtccctaatgctcggtggtttgactatcat
acgggagaagatattggaatcagaggacaagttcaagatttaacactccttatgaatgca
ataaatctacatgttcgtggtggtcacatcctaccatgtcaggaacctgctcgaaccaca
tttttaagtcgacagaagtacatgaagctcattgttgctgcagatgataatcacatggca
caaggatctctcttctgggatgatggggacactatagatacctatgagagagacctgtat
ttatcagtacaatttaatttaaataagacaactttgacaagcacgctattgaaaactggt
tacataaataaaactgaaataagacttggatatgtccatgtatggggcataggaaacact
ttgatcaatgaagttaatttaatgtataatgaaataaattatccacttatatttaaccaa
acccaagcccaagagatattaaatattgatctgacggcacatgaagttactctagatgac
ccaatagaaatctcctggtcctga

DBGET integrated database retrieval system