KEGG   Oryctolagus cuniculus (rabbit): 100009094Help
Entry
100009094         CDS       T03373                                 

Gene name
PGR
Definition
(RefSeq) progesterone receptor
  KO
K08556  progesterone receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04114  Oocyte meiosis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009094 (PGR)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100009094 (PGR)
   04914 Progesterone-mediated oocyte maturation
    100009094 (PGR)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    100009094 (PGR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100009094 (PGR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ocu03310]
    100009094 (PGR)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    100009094 (PGR)
Nuclear receptors [BR:ocu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100009094 (PGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 100009094
NCBI-ProteinID: NP_001075736
Ensembl: ENSOCUG00000014693
UniProt: P06186
Position
1
AA seq 930 aa AA seqDB search
MTELKAKEPRAPHVAGGAPSPTEVGSQLLGRPDPGPFQGSQTSEASSVVSAIPISLDGLL
FPRPCQGQNPPDGKTQDPPSLSDVEGAFPGVEAPEGAGDSSSRPPEKDSGLLDSVLDTLL
APSGPGQSHASPATCEAISPWCLFGPDLPEDPRAAPATKGVLAPLMSRPEDKAGDSSGTA
AAHKVLPRGLSPSRQLLLPSSGSPHWPAVKPSPQPAAVQVDEEDSSESEGTVGPLLKGQP
RALGGTAAGGGAAPVASGAAAGGVALVPKEDSRFSAPRVSLAEQDAPVAPGRSPLATSVV
DFIHVPILPLNHAFLATRTRQLLEGESYDGGAAAASPFVPQRGSPSASSTPVAGGDFPDC
TYPPDAEPKDDAFPLYGDFQPPALKIKEEEEAAEAAARSPRTYLVAGANPAAFPDFQLAA
PPPPSLPPRVPSSRPGEAAVAASPGSASVSSSSSSGSTLECILYKAEGAPPQQGPFAPLP
CKPPGAGACLLPRDGLPSTSASGAAAGAAPALYPTLGLNGLPQLGYQAAVLKEGLPQVYT
PYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQH
NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALPQP
VGIPNESQRITFSPSQEIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGE
RQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLI
LNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQSQFEE
MRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSV
EFPEMMSEVIAAQLPKILAGMVKPLLFHKK
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgactgagctgaaggcaaaggaacctcgggctccccacgtggcgggcggcgcgccctcc
cccaccgaggtcggatcccagctcctgggtcgcccggaccctggccccttccaggggagc
cagacctcagaggcctcgtctgtagtctccgccatccccatctccctggacgggttgctc
ttcccccggccctgtcaggggcagaaccccccagacgggaagacgcaggacccaccgtcg
ttgtcagacgtggagggcgcatttcctggagtcgaagccccggagggggcaggagacagc
agctcgagacctccagaaaaggacagcggcctgctggacagtgtcctcgacacgctcctg
gcgccctcgggtcccgggcagagccacgccagccctgccacctgcgaggccatcagcccg
tggtgcctgtttggccccgaccttcccgaagacccccgggctgcccccgctaccaaaggg
gtgttggccccgctcatgagccgacccgaggacaaggcaggcgacagctctgggacggca
gcggcccacaaggtgctgcccaggggactgtcaccatccaggcagctgctgctcccctcc
tctgggagccctcactggccggcagtgaagccatccccgcagcccgctgcggtgcaggta
gacgaggaggacagctccgaatccgagggcaccgtgggcccgctcctgaagggccaacct
cgggcactgggaggcacggcggccggaggaggagctgcccccgtcgcgtctggagcggcc
gcaggaggcgtcgcccttgtccccaaggaagattctcgcttctcggcgcccagggtctcc
ttggcggagcaggacgcgccggtggcgcctgggcgctccccgctggccacctcggtggtg
gatttcatccacgtgcccatcctgcctctcaaccacgctttcctggccacccgcaccagg
cagctgctggagggggagagctacgacggcggggccgcggccgccagccccttcgtcccg
cagcggggctccccctctgcctcgtccacccctgtggcgggcggcgacttccccgactgc
acctacccgcccgacgccgagcccaaagatgacgcgttccccctctacggcgacttccag
ccgcccgccctcaagataaaggaggaggaagaagccgccgaggccgcggcgcgctccccg
cgtacgtacctggtggctggtgcaaaccccgccgccttcccggacttccagctggcagcg
ccgccgccaccctcgctgccgcctcgagtgccctcgtccagacccggggaagcggcggtg
gcggcctccccaggcagtgcctccgtctcctcctcgtcctcgtcggggtcgaccctggag
tgcatcctgtacaaggcagaaggcgcgccgccccagcagggccccttcgcgccgctgccc
tgcaagcctccgggcgccggcgcctgcctgctcccgcgggacggcctgccctccacctcc
gcctcgggcgcagccgccggggccgcccctgcgctctacccgacgctcggcctcaacgga
ctcccgcaactcggctaccaggccgccgtgctcaaggagggcctgccgcaggtctacacg
ccctatctcaactacctgaggccggattcagaagccagtcagagcccacagtacagcttc
gagtcactacctcagaagatttgtttgatctgtggggatgaagcatcaggctgtcattat
ggtgtcctcacctgtgggagctgtaaggtcttctttaaaagggcaatggaagggcagcat
aactatttatgtgctggaagaaatgactgcattgttgataaaatccgcaggaaaaactgc
ccggcgtgtcgccttagaaagtgctgtcaagctggcatggtccttggagggcgaaagttt
aaaaagttcaataaagtcagagtcatgagagcactcgatgctgttgctctcccacagcca
gtgggcattccaaatgaaagccaacgaatcactttttctccaagtcaagagatacagtta
attccccctctaatcaacctgttaatgagcattgaaccagatgtgatctatgcaggacat
gacaacacaaagcctgatacctccagttctttgctgacgagtcttaatcaactaggcgag
cggcaacttctttcagtggtaaaatggtccaaatctcttccaggttttcgaaacttacat
attgatgaccagataactctcatccagtattcttggatgagtttaatggtatttggacta
ggatggagatcctacaaacatgtcagtgggcagatgctgtattttgcacctgatctaata
ttaaatgaacagcggatgaaagaatcatcattctattcactatgccttaccatgtggcag
ataccgcaggagtttgtcaagcttcaagttagccaagaagagttcctctgcatgaaagta
ttactacttcttaatacaattcctttggaaggactaagaagtcaaagccagtttgaagag
atgagatcaagctacattagagagctcatcaaggcaattggtttgaggcaaaaaggagtt
gtttccagctcacagcgtttctatcagctcacaaaacttcttgataacttgcatgatctt
gtcaaacaacttcacctgtactgcctgaatacatttatccagtcccgggcgctgagtgtt
gaatttccagaaatgatgtctgaagttattgctgcacagttacccaagatattggcaggg
atggtgaaaccacttctctttcataaaaagtga

DBGET integrated database retrieval system