KEGG   Oryctolagus cuniculus (rabbit): 100009164Help
Entry
100009164         CDS       T03373                                 

Gene name
AGTR1, AGTR1A
Definition
(RefSeq) angiotensin II receptor type 1
  KO
K04166  angiotensin II receptor type 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04080  Neuroactive ligand-receptor interaction
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04614  Renin-angiotensin system
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04927  Cortisol synthesis and secretion
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04934  Cushing syndrome
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100009164 (AGTR1)
   04020 Calcium signaling pathway
    100009164 (AGTR1)
   04072 Phospholipase D signaling pathway
    100009164 (AGTR1)
   04022 cGMP-PKG signaling pathway
    100009164 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100009164 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100009164 (AGTR1)
   04614 Renin-angiotensin system
    100009164 (AGTR1)
   04925 Aldosterone synthesis and secretion
    100009164 (AGTR1)
   04927 Cortisol synthesis and secretion
    100009164 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009164 (AGTR1)
   04270 Vascular smooth muscle contraction
    100009164 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009164 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009164 (AGTR1)
   04934 Cushing syndrome
    100009164 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009164 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100009164 (AGTR1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100009164 (AGTR1)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Peptide
   Angiotensin
    100009164 (AGTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100009164
NCBI-ProteinID: NP_001075793
Ensembl: ENSOCUG00000025557
UniProt: P34976
Position
14
AA seq 359 aa AA seqDB search
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaactcttctaccgaagatggtatcaaaagaatccaggatgactgtcccaaa
gctggaaggcacaattacatatttgtcatgattcctactctgtatagcatcatctttgtg
gtgggaatatttgggaacagcttggcggtgattgtcatttacttttacatgaaactcaag
actgtggccagtgtttttcttttgaatttagcattggctgacttatgctttttactgact
ttgccactctgggctgtctacactgctatggaataccgctggccctttggcaattacctg
tgtaagattgcttcggccagtgtcagtttcaacctctatgccagtgtatttctactcacg
tgtctcagcattgaccgctacctggctattgtccacccgatgaagtctcgccttcgacgc
acaatgcttgtagccaaagtcacctgcatcattatttggctgctggctggcttggccagt
ttaccagctatcatccaccgaaacgtatttttcatcgagaacaccaacatcacggtttgt
gctttccattacgagtcccaaaactcaaccctccccatagggctaggcctgaccaaaaat
atactgggcttcctatttccctttctgatcattcttacaagctacactcttatttggaag
gccctcaagaaggcttacgagattcagaagaacaagccaagaaatgatgatatttttaag
atcattatggcaattgtgcttttctttttcttctcctgggttccccaccaaatattcact
ttcctggatgtgttgattcagctgggggtcattcacgactgcagaatcgcagatatcgtg
gacactgccatgcccatcaccatctgcatagcttattttaacaactgcctgaatcccctt
ttttatggctttctggggaaaaaatttaagaaatattttctccagcttcttaaatatatt
cccccgaaagccaaatcccattcaaatctatcaacaaagatgagcacgctctcctaccgc
ccctcagataacgtgagctcatcctccaagaagcccgtgccctgctttgaggttgagtga

DBGET integrated database retrieval system