KEGG   Oryctolagus cuniculus (rabbit): 100009198Help
Entry
100009198         CDS       T03373                                 

Gene name
BDKRB1
Definition
(RefSeq) bradykinin receptor B1
  KO
K03915  bradykinin receptor B1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04080  Neuroactive ligand-receptor interaction
ocu04610  Complement and coagulation cascades
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100009198 (BDKRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100009198 (BDKRB1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009198 (BDKRB1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100009198 (BDKRB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100009198 (BDKRB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009198 (BDKRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100009198 (BDKRB1)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Peptide
   Bradykinin
    100009198 (BDKRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 100009198
NCBI-ProteinID: NP_001075816
Ensembl: ENSOCUG00000026468
UniProt: P48748
Position
Un
AA seq 352 aa AA seqDB search
MASQGPLELQPSNQSQLAPPNATSCSGAPDAWDLLHRLLPTFIIAIFTLGLLGNSFVLSV
FLLARRRLSVAEIYLANLAASDLVFVLGLPFWAENVRNQFDWPFGAALCRIVNGVIKANL
FISIFLVVAISQDRYSVLVHPMASRRGRRRRQAQATCALIWLAGGLLSTPTFVLRSVRAV
PELNVSACILLLPHEAWHWLRMVELNLLGFLLPLAAILFFNCHILASLRRRGERVPSRCG
GPRDSKSTALILTLVASFLVCWAPYHFFAFLECLWQVHAIGGCFWEEFTDLGLQLSNFSA
FVNSCLNPVIYVFVGRLFRTKVWELCQQCSPRSLAPVSSSRRKEMLWGFWRN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcctcacagggccccctggagctccagccctccaaccagagccagctcgcccctcct
aatgccacgtcctgcagcggcgccccggacgcctgggacctgctgcacaggctgctgccc
acgttcatcattgccatcttcaccctcggcctcctgggaaactctttcgtcctgtccgtc
ttcctcctggcccggcggcgactgagtgtggcagaaatctacctggccaacctggccgct
tctgacctggtgtttgtcctgggcttgcccttctgggcagagaatgtgcggaaccaattc
gactggcccttcggggccgccctctgccgcatcgtgaacggggtcatcaaggccaacctg
ttcatcagcatcttcctggtggtggccatcagccaggaccgctacagcgtgctggtgcac
cccatggccagccggagggggcggcggcggcggcaggctcaggccacctgcgcgctcatc
tggctcgcggggggcctcctgagcacccccaccttcgtgctgcgctccgtcagagccgtc
ccggagctcaacgtctccgcctgcatcctgctgctcccgcacgaggcctggcactggctg
aggatggtggagttgaacctgctgggcttcctcctcccgctggccgccatcctgttcttc
aactgccacatcctggcctccctgcggaggcggggggagcgcgtcccctcgcggtgcggg
ggcccccgggacagcaagagcacggcgctcatcctcactctcgtggcttccttcctggtc
tgctgggccccctaccacttcttcgcgttcctggaatgcctgtggcaggtgcacgccatc
gggggctgcttctgggaggagttcaccgacctgggcctgcagctgtccaacttctccgct
ttcgtcaacagctgcctgaacccggtgatttatgtgtttgtgggccggctcttcaggacc
aaggtctgggaactctgtcaacagtgcagccccaggagtctcgcacccgtgtcctcgtcc
cgtaggaaagaaatgctctggggtttctggcggaattaa

DBGET integrated database retrieval system