KEGG   Oryctolagus cuniculus (rabbit): 100009251Help
Entry
100009251         CDS       T03373                                 

Gene name
MME, SFE
Definition
(RefSeq) membrane metalloendopeptidase
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04614  Renin-angiotensin system
ocu04640  Hematopoietic cell lineage
ocu04974  Protein digestion and absorption
ocu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100009251 (MME)
  09152 Endocrine system
   04614 Renin-angiotensin system
    100009251 (MME)
  09154 Digestive system
   04974 Protein digestion and absorption
    100009251 (MME)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009251 (MME)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100009251 (MME)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009251 (MME)
   04090 CD molecules [BR:ocu04090]
    100009251 (MME)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     100009251 (MME)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M13: neprilysin family
   100009251 (MME)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100009251 (MME)
CD molecules [BR:ocu04090]
 Proteins
  100009251 (MME)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Motif
Other DBs
NCBI-GeneID: 100009251
NCBI-ProteinID: NP_001095155
Ensembl: ENSOCUG00000017924
UniProt: P08049
Structure
PDB: 

Position
14
AA seq 750 aa AA seqDB search
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCVNETAIDSRGGQPLLKLLPDVYGWPVATQNWEQTYGT
SWSAEKSIAQLNSNYGKKVLINFFVGTDDKNSMNHIIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMIAVAKLIRQEEGLPIDENQISVEMNKVMELEKEIANATTKSEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWSNFTNEIMSTVNINIPNEEDVVVYAPEYLIKLKPILT
KYFPRDFQNLFSWRFIMDLVSSLSRTYKDSRNAFRKALYGTTSESATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWITGAA
IVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGIDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GSLQNSVEFSEAFQCPKNSYMNPEKKCRVW
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggaagatcagaaagtcagatggatataactgatatcaacactccaaagccaaagaag
aaacagcgatggactcctctggagatcagtctctcagtccttgtcctgctcctcactgtc
atagctgtgacgatgatagcactctatgcaacctatgacgatggtatttgcaaatcatca
gactgcataaaatcagctgctcgactgatccagaacatggatgccactgctgagccctgc
acagactttttcaagtatgcctgtggtggttggctgaaacgcaacgtcatcccggagacc
agctcccgttacagtaactttgacattttaagagatgagctagaagtcattttgaaagat
gtccttcaggagcccaaaaccgaagatatcgtggcagtgcaaaaagcaaaaacactgtac
aggtcttgtgtaaatgaaactgctattgacagtagaggtggacaacctctactcaaattg
ttaccagatgtgtatgggtggccagtagcaacacaaaactgggagcaaacatacggtact
tcttggtcagctgagaaatctattgcacaactgaattctaactatgggaaaaaagtcctg
attaatttctttgttggcactgatgataagaactctatgaaccatataattcatattgac
caacctcgacttggcctcccttctagagactactatgaatgcactggaatatataaagag
gcttgtacagcatatgtggattttatgattgctgtggccaaattgattcgtcaggaagaa
ggattgcctattgatgaaaaccagatttctgtggaaatgaataaagttatggaattggaa
aaagaaatagccaatgctacgactaaatctgaagatagaaatgatccaatgcttctctat
aacaaaatgacattggcccagatccaaaataacttttcactagagatcaacgggaagcca
ttcagctggtcaaatttcacaaatgaaatcatgtcaacagtgaatattaatattccaaat
gaagaagatgtggttgtttatgctccagaatatttaatcaaacttaagcccattcttacc
aaatattttcccagagattttcaaaatttattttcctggcggttcataatggatcttgta
agcagcctcagccgaacctacaaggactccagaaatgctttccgcaaggccctttatggc
accacatcagaatctgcaacttggagacgttgtgcaaactatgtcaatgggaatatggaa
aatgccgtgggaaggctttatgtggaagcagcgtttgctggagagagtaaacatgtggtt
gaggatttgattgcgcagatccgggaagttttcattcagactttagatgacctcacctgg
atggatgccgaaacaaaaaagaaagctgaagaaaaggccttagcaattaaggaaaggatt
ggctatcctgatgacattgtttcgaatgataacaaactgaataatgaatacctggagctg
aactacaaagaagatgaatactttgagaacataattcaaaatctgaaattcagccaaagc
aaacaactaaagaagcttcgagaaaaggtggacaaggatgagtggataactggagcagct
atagtcaatgcattttattcttcaggcagaaatcaaatagtcttcccggctggcattctg
cagcccccattctttagtgcccagcagtccaactcattgaattatgggggcatcggcatg
gtcataggacatgaaatcactcacggcttcgatgataacggcagaaattttaataaagat
ggagaccttgttgactggtggactcaacagtctgcaaataattttaaagaacagtcccag
tgcatggtgtaccagtatggaaacttctcctgggatctagcaggtggacaacacctcaac
ggaattaacacactgggagaaaacattgctgataatggaggcattggccaagcatacaga
gcctatcagaattatgttaaaaagaatggagaagaaaaattacttcctggaattgacctc
aatcacaaacaactattcttcttgaactttgcccaggtatggtgtgggacctacaggcca
gagtatgcagtcaattccattaaaacagatgtgcacagtccaggcaatttcaggattatt
ggatctttgcagaactctgttgagttttcagaagcctttcagtgccccaagaactcatac
atgaatccagaaaagaaatgccgggtttggtga

DBGET integrated database retrieval system