KEGG   Oryctolagus cuniculus (rabbit): 100009258Help
Entry
100009258         CDS       T03373                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00480  Glutathione metabolism
ocu00590  Arachidonic acid metabolism
ocu01100  Metabolic pathways
ocu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100009258 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100009258 (GPX1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100009258 (GPX1)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100009258 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 100009258
NCBI-ProteinID: NP_001078913
UniProt: P11909
Position
9
AA seq 200 aa AA seqDB search
MCAARMAAAAQSVYSFSAHPLAGGEPVNLGSLRGKVLLIENVASLUGTTVRDYTQMNELQ
ERLGPRALVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFQKCEVNGAKAS
PLFAFLREALPPPSDDPTALMTDPKFITWCPVCRNDVSWSFEKFLVGPDGVPVRRYSRRF
PTIDIEPDIQALLSKGSGGA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcggctcgtatggcggcggctgcccagtctgtgtactccttctcagcgcacccg
ctggccggcggggagcccgtgaacctgggctccctgcggggcaaggtgctgctcattgag
aatgtggcgtcgctctgaggcactacggtccgggactacacccagatgaacgagctgcaa
gagcgcctcgggccccgggccctggtcgtgctcggcttcccgtgcaaccagtttgggcat
caggagaacgccaagaatgaggagattctgaattccctcaagtatgtccggcctggaggc
gggttcgagcccaacttcatgctcttccagaagtgcgaggtgaacggcgccaaggccagc
ccgctcttcgccttcctgcgggaggccctgccgccgcccagcgacgaccccactgcgctc
atgaccgaccccaagttcatcacctggtgcccggtgtgccgtaacgacgtttcctggagc
ttcgagaagttcctggtgggccccgatggtgttcccgtgcgcaggtacagccgccgcttc
cccaccatcgacatcgagcccgacatccaagccctgctgtccaaggggtctggcggtgcc
tag

DBGET integrated database retrieval system