KEGG   Oryctolagus cuniculus (rabbit): 100009276
Entry
100009276         CDS       T03373                                 

Gene name
MLN
Definition
(RefSeq) motilin
  KO
K05265  motilin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100009276 (MLN)
SSDB
Motif
Pfam: Motilin_ghrelin Motilin_assoc
Other DBs
NCBI-GeneID: 100009276
NCBI-ProteinID: NP_001095169
UniProt: P27114
Position
12
AA seq 133 aa
MVSRKAVAALLLVHVTAMLASQTEAFVPIFTYSELQRMQERERNRGHKKSLSVQQRSDAA
AAPRPAEPTLEEENGRMQLTAPVEIGMRMNSRQLEKYRAALEAAERAVHPDAPSRPCWPA
GGESGWSGEPSPT
NT seq 402 nt   +upstreamnt  +downstreamnt
atggtgtcccgcaaggccgtggctgccctgctgctggtgcacgtgaccgccatgctggcc
tcccagacggaagccttcgtccccatcttcacctacagcgaactccagaggatgcaggaa
agggagcggaacagagggcacaagaagtccctgagcgtgcagcagaggtctgacgcagcg
gccgctccaaggcctgcggagcccaccctggaagaggaaaacgggaggatgcagctgact
gctcctgtggaaattggaatgaggatgaactccaggcagctggaaaagtaccgggccgcc
ctggaagctgcagagcgggctgtccacccagacgctccgagtcggccctgctggcctgcc
gggggagaaagtggatggagcggggagccctctcccacctga

DBGET integrated database retrieval system