KEGG   Oryctolagus cuniculus (rabbit): 100009301Help
Entry
100009301         CDS       T03373                                 

Gene name
CYP8B1
Definition
(RefSeq) cytochrome P450, family 8, subfamily B, polypeptide 1
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00120  Primary bile acid biosynthesis
ocu01100  Metabolic pathways
ocu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    100009301 (CYP8B1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100009301 (CYP8B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ocu00199]
    100009301 (CYP8B1)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     100009301 (CYP8B1)
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     100009301 (CYP8B1)
Cytochrome P450 [BR:ocu00199]
 Cytochrome P450, animal type
  CYP8 family
   100009301 (CYP8B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100009301
NCBI-ProteinID: NP_001076091
Ensembl: ENSOCUG00000006887
UniProt: O02766
Position
9
AA seq 500 aa AA seqDB search
MVLWGLLGALLMVMVGWLCLPGLLRQRRPQEPPLDKGSIPWLGHAMTFRKNMLEFLKHMR
SKHGDVFTVQLGGQYFTFVMDPVSFGPILKDGQRKLDFVEYAKGLVLKVFGYQSIEGDHR
MIHLASTKHLMGHGLEELNKAMLDSLSLVMLGPEGRSPDASRWHEDGLFHFCYGVMFKAG
YLSLFGHTSDKRQDLLQAEEIFIKFRRFDLLFPRFVYSLLGPREWREVGRLQQLFHELLS
VKHNPEKDGMSNWIGHMLQYLSEQGVAPAMQDKFNFMMLWASQGNTGPASFWALIYLLKH
PEAMRAVKEEATRVLGEPRLEAKQSFTVQLSALQHIPVLDSVMEETLRLGAAPTLYRVVQ
KDILLKMASGQECLLRQGDIVTLFPYLSVHMDPDIHPEPTTFKYDRFLNPNGSRKVDFYK
AGQKIHHYTMPWGSGVSICPGRFFALSEMKLFVLLMVQYFDLELVDPNTPVPPIDPRRWG
FGTMQPTHDVRIRYRLKPLE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctggggactgctaggggccctgctcatggtcatggttgggtggctgtgctta
ccagggctgcttcggcagcgcagaccccaggagcctcctctggacaagggcagcataccc
tggctgggccatgccatgactttccggaagaacatgctggaattcctgaagcacatgcgg
tccaagcacggggatgtgttcacagtgcagctgggcggccagtacttcacctttgtcatg
gaccccgtctccttcggccccatcctcaaggatgggcagagaaaactcgactttgtggag
tacgcaaagggcctggtgctgaaggtgtttggataccagtcgatagaaggggaccaccgg
atgatacacttggccagcaccaagcacctgatgggacatggcttggaggagctcaataag
gccatgctggacagcctgtcactggtgatgctggggcctgaaggcaggagcccggatgcc
agccgctggcatgaggatggcctctttcacttctgctacggtgtcatgttcaaggctggc
tacctgagtttgttcggtcacaccagcgacaagaggcaggacttgctccaggccgaggag
atattcatcaagttccgcaggttcgacctactcttccccaggtttgtctactccttgctg
gggccccgggagtggcgagaagtgggccggctccagcagctcttccacgagctgctgtct
gtgaaacacaacccggagaaggatggcatgagcaattggataggccacatgcttcagtat
ctcagtgagcaaggggtagccccagctatgcaggacaagttcaacttcatgatgctctgg
gcctcccaggggaacacaggaccggcctccttctgggctctcatttacctcctgaagcat
ccggaagccatgcgggccgtgaaggaggaggccacccgggtgctgggtgagcctaggctg
gaagccaagcagtccttcaccgtccagctcagtgccttgcaacacatcccggtgctggac
agcgtgatggaggagacgctgcggctgggggctgcccccacgctctacagggtggtacag
aaagacatcctcctgaagatggccagtgggcaggagtgtctgctccgccagggggacatc
gtgaccctcttcccctacctctcagtgcacatggaccctgacatccaccccgagcccacc
accttcaagtatgaccgattcctcaaccccaatggcagcagaaaagtagacttctacaag
gcaggccagaagatccatcactacaccatgccctggggctcgggcgtctccatctgcccg
gggaggttctttgcgctcagcgagatgaagctctttgtcctgctcatggtgcagtacttt
gacctggaactggtggatcctaacacacctgtgccacctattgaccctcggcgctggggc
tttggcaccatgcagcccacccacgatgtgcgaatccgctaccgcctgaagcctctggag
tga

DBGET integrated database retrieval system