KEGG   Oryctolagus cuniculus (rabbit): 100009334Help
Entry
100009334         CDS       T03373                                 

Gene name
CTSK, OC-2
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04142  Lysosome
ocu04210  Apoptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100009334 (CTSK)
  09143 Cell growth and death
   04210 Apoptosis
    100009334 (CTSK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100009334 (CTSK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100009334 (CTSK)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009334 (CTSK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100009334 (CTSK)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100009334 (CTSK)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     100009334 (CTSK)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C1: papain family
   100009334 (CTSK)
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Papain family
   100009334 (CTSK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 100009334
NCBI-ProteinID: NP_001076110
Ensembl: ENSOCUG00000011090
UniProt: P43236
Structure
PDB: 

Position
13
AA seq 329 aa AA seqDB search
MWGLKVLLLPVVSFALHPEEILDTQWELWKKTYSKQYNSKVDEISRRLIWEKNLKHISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSRSHSNDTLYIPDWEGRTPDSID
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGG
YMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGE
SWGNKGYILMARNKNNACGIANLASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtggggactcaaggttctgctgctacccgtggtgagttttgctctgcaccctgaggaa
atactggacacccagtgggagctatggaagaagacctacagcaagcagtataacagcaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagcatatttctatccat
aaccttgaagcctctcttggtgtccatacatatgaactggccatgaaccacctgggggac
atgaccagtgaagaggtggttcagaagatgactggcctcaaagtacccccgtctcgttcc
cacagtaatgacacactctacatccctgactgggagggcagaaccccagactccatcgac
tatcgaaagaagggatacgttactcctgtcaaaaaccagggtcagtgtggttcctgttgg
gctttcagctctgtgggtgccctcgagggccagctcaagaagaagactggcaaactctta
aacctgagcccccagaacctggtggattgtgtgtctgagaattatggctgtggagggggc
tacatgaccaatgccttccagtatgtgcagaggaaccggggcattgactctgaagatgcc
tacccctacgtgggacaggatgaaagttgtatgtacaatccgactggcaaggcagccaaa
tgcagagggtacagagagatccctgaggggaatgagaaagccctgaagagggcagtggcc
cgagtgggacccgtctctgtggccattgatgcaagcctgacctccttccagttttacagt
aaaggtgtatattatgatgaaaactgcagtagtgacaatgtgaaccatgcggttttggcc
gtgggctatggaatccagaagggaaataagcactggataattaagaacagctggggagaa
agctggggaaacaaaggctatatcctcatggctcggaataagaacaacgcctgtggcatt
gccaacctggccagcttccctaagatgtga

DBGET integrated database retrieval system