KEGG   Oryctolagus cuniculus (rabbit): 100009338Help
Entry
100009338         CDS       T03373                                 

Gene name
EIF4E, EIF-4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu03013  RNA transport
ocu04066  HIF-1 signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04211  Longevity regulating pathway
ocu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100009338 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100009338 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100009338 (EIF4E)
   04150 mTOR signaling pathway
    100009338 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100009338 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    100009338 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100009338 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009338 (EIF4E)
   03012 Translation factors [BR:ocu03012]
    100009338 (EIF4E)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100009338 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100009338 (EIF4E)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    100009338 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100009338
NCBI-ProteinID: NP_001095180
UniProt: P29338
Position
15
AA seq 217 aa AA seqDB search
MATVEPETTPTPNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccacctgcagaagaggag
aaaacagagtctaatcaggaggttgctaacccagaacactatattaaacatcctctacag
aacaggtgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacggggaggacgatggctaattacgttgaacaaacag
cagagacgaagtgacctcgatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagcgatgatgtatgtggagctgttgttaatgttagagctaaaggt
gataaaatagcaatatggactactgaatgtgaaaatagagatgctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system