KEGG   Oryctolagus cuniculus (rabbit): 100009399Help
Entry
100009399         CDS       T03373                                 

Gene name
F7
Definition
(RefSeq) coagulation factor VII
  KO
K01320  coagulation factor VII [EC:3.4.21.21]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100009399 (F7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100009399 (F7)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.21  coagulation factor VIIa
     100009399 (F7)
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100009399 (F7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla DUF1986 FXa_inhibition EGF cEGF hEGF
Motif
Other DBs
NCBI-GeneID: 100009399
NCBI-ProteinID: NP_001076148
Ensembl: ENSOCUG00000021021
UniProt: P98139
Position
Un
AA seq 444 aa AA seqDB search
MAPQARGLGLCSLLALQASLAAVFITQEEAHSVLRRQRRANSFLEELRPGSLERECKEEL
CSFEEAREVFQSTERTKQFWITYNDGDQCASNPCQNGGSCEDQIQSYICFCLADFEGRNC
EKNKNDQLICMYENGGCEQYCSDHVGSQRSCRCHEGYTLLPNGVSCTPTVDYPCGKVPAL
EKRGASNPQGRIVGGKVCPKGECPWQAALMNGSTLLCGGSLLDTHWVVSAAHCFDKLSSL
RNLTIVLGEHDLSEHEGDEQVRHVAQLIMPDKYVPGKTDHDIALLRLLQPAALTNNVVPL
CLPERNFSESTLATIRFSRVSGWGQLLYRGALARELMAIDVPRLMTQDCVEQSEHKPGSP
EVTGNMFCAGYLDGSKDACKGDSGGPHATSYHGTWYLTGVVSWGEGCAAVGHVGVYTRVS
RYTEWLSRLMRSKLHHGIQRHPFP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccaggcccgcgggctgggcctctgctcccttctcgcgctccaagcgtctctg
gctgcagtctttataacccaggaggaggcgcacagcgtcctgcgcaggcaaaggcgggcc
aattctttcctggaggagctgcggccgggctcgctggagagggagtgcaaggaagagctg
tgctccttcgaggaggcgcgggaggtcttccagagcaccgagaggacgaagcagttctgg
atcacttacaatgatggggatcagtgtgcctccaacccgtgccagaacggaggctcctgt
gaggaccaaatccagtcctacatctgcttctgcctggctgacttcgagggtcgcaactgt
gagaaaaacaagaacgaccagctgatctgcatgtacgagaatgggggctgtgagcagtac
tgcagcgaccacgtggggagccagcgctcctgccgctgccacgagggctacacgctgctg
cccaatggggtgtcctgcacacccacagttgattacccatgcggcaaagtacctgctctg
gaaaagagaggcgccagcaacccccagggccggattgtggggggcaaggtgtgccccaaa
ggggagtgcccgtggcaggccgcgctgatgaacggcagcacgctactgtgtgggggttcc
ctactggacacccactgggtggtctccgctgcccactgcttcgacaaactcagcagcctg
aggaacctgaccatagtgctgggcgagcatgacctcagtgagcacgagggggacgagcag
gtgcggcacgtggcacagctcatcatgcccgacaagtacgttccaggcaagaccgaccac
gacatcgctctgctgcgcctgctgcagcccgcggccctcaccaacaacgtggtgcccctc
tgtctgcccgagaggaacttctccgagagcacgctggccaccatccgcttctcccgggtg
agcggctggggccagctcctgtaccgcggcgccttagcccgggagctcatggccatcgac
gtgccgcggctgatgacccaggactgcgtggaacagtctgagcacaagccaggctccccg
gaggtcacggggaacatgttctgtgccggctacctggacggcagcaaggacgcctgcaag
ggggacagcgggggcccacatgccacctcctaccacggcacgtggtacctgacgggtgtg
gtgagctggggcgagggctgcgcagccgtgggccacgtcggcgtgtacaccagggtctcg
cgctacactgagtggctgagcaggctcatgcgctccaagctacaccacggcatccagcgc
cacccgttcccctag

DBGET integrated database retrieval system