KEGG   Oryctolagus cuniculus (rabbit): 100009409Help
Entry
100009409         CDS       T03373                                 

Gene name
CD38, ADPRC_1
Definition
(RefSeq) CD38 molecule
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00760  Nicotinate and nicotinamide metabolism
ocu01100  Metabolic pathways
ocu04020  Calcium signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04921  Oxytocin signaling pathway
ocu04970  Salivary secretion
ocu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100009409 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100009409 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100009409 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100009409 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    100009409 (CD38)
   04972 Pancreatic secretion
    100009409 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100009409 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009409 (CD38)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     100009409 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     100009409 (CD38)
CD molecules [BR:ocu04090]
 Proteins
  100009409 (CD38)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Hyaluronan
  Cell surface receptors
   100009409 (CD38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 100009409
NCBI-ProteinID: NP_001076152
Ensembl: ENSOCUG00000017793
UniProt: Q9MZ03
Position
2
AA seq 298 aa AA seqDB search
MPDYEFSPASGDRPRSWISKQVLIVLGVCLPVILALAIWVGVLTWRQSSMGATDHVSAIV
LGRCLTYTRNMHPELRNQDCKKILNTFTSAFVSKDPCNITKEDYQPLIDLVTQTVPCNKT
LFWSRSKELAHQYSGIQKEMFTLEDTLLGYIADNLVWCGDPRTSEVKEEFCPYRNENCSS
TATSVFWTVVSQKFAESACGTVYVMLNGSRTTAFSKASTFGSVEVFNLHPDRVHTLHAWV
MHDIGGVERDSCLGSSIKELKSIVNQRNISFFCQDDYRPARFVQCVRHPEHPSCSVLM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactacgagttcagccccgcgtcgggggacagaccccgcagctggatctctaag
caagtcctgatcgtcctcggcgtgtgtctcccggtgattttggccctggcgatctgggtg
ggagtcctgacctggcgccagagctccatgggcgccaccgaccacgtctctgcgatcgtc
ctggggcgatgcctcacctacacacggaacatgcacccggagctgagaaatcaggattgt
aaaaaaatactgaacaccttcacaagtgcatttgtttccaaggatccttgcaacattaca
aaagaagactatcaaccactgattgatttggtcactcaaactgttccttgcaacaagact
ctcttttggagcagatcaaaagagctggcccatcagtactcagggatccagaaagagatg
ttcactctggaggacacgctgctgggttacattgctgacaaccttgtgtggtgtggagat
cccagaacttctgaagtgaaggaagaattttgcccatatcggaatgaaaactgcagcagc
actgctacttctgtgttctggaccgtggtttctcagaaatttgcagaatctgcctgtggt
accgtctatgtgatgctcaatgggtccagaactacagcctttagcaaagccagcactttt
ggaagtgtggaagtcttcaatttgcacccagacagggttcatacacttcatgcctgggtg
atgcatgacattggaggagttgaaagggactcgtgcttaggttcctccataaaggagttg
aaatcgatcgtaaaccagaggaacatttcctttttctgccaggatgactacaggcctgcc
aggtttgtccaatgcgtgagacatccggagcatccgtcttgcagcgtcctgatgtga

DBGET integrated database retrieval system