KEGG   Oryctolagus cuniculus (rabbit): 100009424Help
Entry
100009424         CDS       T03373                                 

Gene name
ADRA2A
Definition
(RefSeq) adrenoceptor alpha 2A
  KO
K04138  adrenergic receptor alpha-2A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100009424 (ADRA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100009424 (ADRA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100009424 (ADRA2A)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100009424 (ADRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100009424
NCBI-ProteinID: NP_001076162
UniProt: Q5ZQK3
Position
18
AA seq 451 aa AA seqDB search
MGSLQPDAGNGSWNGSEAPGGGARASPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGQAWCEIYLALDMLFCTSS
IAHLCAISLDRHWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIERKGGGGG
GGRQRCEINDHKWYVIASCTGSFFVPCLIMILVYVRIYQIAKRRTRVPPSRRVRTPPPPP
PPPPPPPRQPGPPSAGLMAWAPERGAGSASAETEPLPTQLNGAAGEPAAAGPRETDALDL
EESSSSEHAERPPGPASRGPRQGPSEPGEARGQHPSARARDRGARGVGGRARGDTPEAPR
RLWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNS
SLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggctccctgcagccggacgcgggcaacgggagctggaacgggagcgaggcgccaggg
ggcggcgcccgggccagcccgtactccctgcaggtgacgctcacgctggtgtgcctggcc
ggcctgctcatgctgctcaccgtgttcggcaacgtgctggtcatcatcgccgtgttcacc
agccgcgcgctcaaggcgccccaaaacctcttcctggtgtcgctggcctcggccgacatc
ctggtggccacgcttgtcatccccttctcgctggccaacgaggtcatgggctactggtat
tttggccaggcgtggtgcgagatctacctggcgctcgacatgctcttctgcacgtcgtcc
atcgcgcacctgtgcgccatcagcctggaccgccactggtccatcacgcaggccatcgag
tacaacctgaagcgcacgccgcgccgcatcaaggccatcatcgtcaccgtgtgggtcatc
tcggccgtcatctccttcccgccgctcatctccatcgagaggaagggcggcggcggcggc
ggcgggcggcagcgctgcgaaatcaacgaccacaagtggtacgtgatcgcctcctgcacc
ggctccttcttcgtgccttgcctcatcatgatcctggtctacgtgcgcatctaccagatc
gccaagcgccgcacgcgcgtgccgccaagccgcagggtccggacgcctccgccaccacca
ccgccgccgccgccgccgccgcgccagccggggccgccgagcgcaggcctaatggcctgg
gcccccgagcgcggcgcgggctccgcgagcgccgagaccgagccgctgcccacgcagctc
aacggcgcggctggcgagcccgcagcggccgggccgcgcgaaaccgacgcgttggacctg
gaggagagctcgtcgtccgagcacgccgagcggcccccgggccccgcaagccgcgggccc
cggcaaggcccgagcgagccaggtgaagcccggggacagcatccctcggcgcgcgcccgg
gaccgcggggcccggggcgtcggcggccgggcccggggagacacgccggaggcgccaagg
cgtctctggcgcgggcggcagaaccgcgaaaaacgcttcacgttcgtgctagccgtggtc
atcggggtgtttgtggtgtgctggttccccttcttcttcacctacacgctcacggccgtc
ggctgctccgtgccgcccacgctcttcaagttcttcttctggttcggctactgcaacagc
tcgctgaacccggtcatctacaccatcttcaaccacgacttccgccgcgccttcaagaag
atcctatgccgcggggacaggaaacgcatcgtgtga

DBGET integrated database retrieval system