KEGG   Oryctolagus cuniculus (rabbit): 100009517Help
Entry
100009517         CDS       T03373                                 

Gene name
ENPP1
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 1
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu00240  Pyrimidine metabolism
ocu00500  Starch and sucrose metabolism
ocu00740  Riboflavin metabolism
ocu00760  Nicotinate and nicotinamide metabolism
ocu00770  Pantothenate and CoA biosynthesis
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100009517 (ENPP1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100009517 (ENPP1)
   00240 Pyrimidine metabolism
    100009517 (ENPP1)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100009517 (ENPP1)
   00760 Nicotinate and nicotinamide metabolism
    100009517 (ENPP1)
   00770 Pantothenate and CoA biosynthesis
    100009517 (ENPP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100009517 (ENPP1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100009517 (ENPP1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     100009517 (ENPP1)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     100009517 (ENPP1)
CD molecules [BR:ocu04090]
 Proteins
  100009517 (ENPP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Enzymes
  100009517 (ENPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100009517
NCBI-ProteinID: NP_001076211
Ensembl: ENSOCUG00000014455
UniProt: B7NZB8
Position
12
AA seq 926 aa AA seqDB search
MERDGCAGGGSQGGGKGGRGPREGLAGNGRDPSHGQASEAPGDPQAAASLLAPMDLGEEP
LEKAAGARPAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGN
CRCDVACVDLGNCCLDYQETCIEPERIWTCNKFRCGEKRLSRSLCACSDDCKERGDCCIN
YSAVCQGEKSWVEETCENINEPQCPEGFEMPPTLLFSLDGFRAEYLHTWGGLLPVISKLK
KCGTYAKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPE
WYKGEPIWLTAKYQGLRSGTFFWPGSDVKINGIFPDIYKIYNGSVPFEERILAILKWLRL
PKDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDNMVGMLMDGLKELNLHQCLNLI
LISDHGMEQGSCKKYIYLNKYLGDTKNIKVIYGPAARLRPSDVPEKYYSFNYENIARNLS
CREPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALSPSERKYCGSGFHGSDN
VFSNMQALFVGYGPGFQHGIEVDSFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPI
YTPKHPKEVQPSVQCPLAGSPRDSLGCSCNPSILPIVDFQTQFNLTTAEEKNINRASLPY
GRPRLLQKKSSVCLLYQHQFVSGYSHDVLMPLWTSYTVNRNDSFSTEDFSNCLYQDLRIS
FSPIHNCSFYKNNAKLSYGFLSPPQLSKDSSQIYSEALLTSNIVPMYQSFQVIWRYFHDT
LLQRYAEERNSINVVSGPVFDSDYDGRYDSSEALKRNRRVIRNQEILIPTHFFIVITSCK
NTSQTPLQCDNLDPLAFILPHRSDNSESCVHEKRESSWIEELLMMHRARIMDVEHITGLS
FYQERKEPVSDILKLKTHLPTVSQED
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggacggctgcgctgggggcgggagccaaggcggcggcaagggcgggcgcggc
ccccgggagggcctggcggggaacggccgcgacccgagccacggccaagcctccgaggcg
cccggggacccgcaggcagccgcgtccttgctggcgcccatggacctgggggaggagccg
ctggagaaggcggcgggcgcccgccctgccaaagaccccaacacctataaagtgctctcg
ctggtattatcggtatgtgtgttaacaacaattcttggttgtatatttgggctgaaacca
agctgtgctaaagaagttaaaagttgcaaaggtcgctgttttgagagaactttcgggaac
tgtcgctgtgatgtggcctgcgttgaccttggaaactgctgtctagattaccaggagacg
tgtatagaaccagaacgcatatggacttgcaacaaattcaggtgcggtgagaaaaggttg
tccagaagcctgtgtgcctgttccgacgactgtaaggagcgtggcgactgctgcatcaac
tatagcgctgtgtgtcaaggtgagaaaagctgggtggaagaaacatgtgagaacataaac
gagcctcagtgtccagaaggatttgaaatgcctcctacactattattttctttggatgga
ttcagagcagaatatttacacacttggggtggacttcttcctgttattagcaaactaaaa
aaatgtggaacatatgcaaaaaacatgagaccagtatacccaacaaaaacctttcccaat
cactacagcattgtcacaggactttatccagaatcccatggcataattgacaataaaatg
tatgatcccaaaatgaatgcttccttttcactgaaaagtaaagagaaatttaatcctgag
tggtacaaaggagagccaatttggctcacagcgaagtatcaaggcctgaggtctggcact
ttcttttggccaggatcagatgtgaaaattaatgggattttcccagacatctacaaaata
tacaatggttcagtgccatttgaagaaagaattttagctattcttaagtggttacggctt
cctaaagatgaaagaccacacttttacactctgtatttagaagaaccagattcttcaggt
cattcatatggaccagtcagcagtgaagtcatcaaggccttgcagagagtggacaacatg
gtgggcatgctgatggatggcctgaaagagctgaacttgcatcagtgtctgaacctcatc
ctcatttcagatcatggcatggaacaaggcagctgtaagaagtatatatatctgaataaa
tatttgggagatactaaaaatattaaagttatctatggacctgcagcccgattgagaccc
tctgatgttcctgagaaatactattcatttaattatgaaaacattgccagaaatctttcc
tgcagggaaccaaaccagcacttcaaaccttacctgaaacatttcttacctaagcgtttg
cattttgcaaaaagtgacagaattgagcccttgacattctatttggaccctcagtggcag
ctggcactgagtccctcagaaaggaaatactgtggaagtggatttcatggctctgacaat
gtgttttcaaatatgcaggccctctttgttggatatggacctggattccagcacggcatt
gaagttgactcctttgaaaacattgaagtctacaacttaatgtgtgatttactgaatttg
acaccagcccctaataatggaacacatggaagtcttaatcaccttctcaagaatcctatt
tatacccccaagcatcctaaagaagtgcagccctcggtacagtgccccttggcaggatcg
cccagagatagccttggctgctcctgcaacccctcaattttgcccattgtggattttcag
acacagtttaatctgaccacggcagaagagaagaacattaaccgtgcgagtttaccctat
ggcagacctagacttctccagaaaaaaagcagtgtctgtctgctttaccagcaccagttt
gtgagtggatacagccatgatgtcctcatgcccctttggacctcctacactgtcaacaga
aatgacagtttctctacggaagacttttctaattgtctctaccaggaccttcggatttct
ttcagtcccatccataactgttcgttttataaaaataatgctaaactgagttacgggttc
ctctccccaccacaactaagtaaagattcaagtcaaatctattctgaagctttgcttacc
tctaatatcgtcccaatgtaccagagttttcaagtgatctggcgctactttcacgacacc
ctgctgcagaggtatgctgaggaaaggaacagcatcaatgtcgtcagtggtcctgtgttt
gactctgattatgatggacgttacgattcctcggaggctctgaagcgaaacagaagagta
attcgtaatcaagaaattctaattccaactcacttctttattgtgataacaagttgtaaa
aacacgtcccagactcccttgcagtgtgacaacttggatcccttagctttcatcttgccc
cacaggtccgataacagtgagagctgtgtgcacgagaagcgtgagtcctcatggattgaa
gagttgttaatgatgcacagagctcggatcatggatgttgaacacatcactggactcagc
ttctatcaagaaaggaaagagccagtttcagacattttaaaactgaaaacacatttgcca
accgtcagccaagaagactga

DBGET integrated database retrieval system