KEGG   Oryctolagus cuniculus (rabbit): 100009551
Entry
100009551         CDS       T03373                                 

Definition
(RefSeq) liver carboxylesterase
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100009551
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100009551
SSDB
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Abhydrolase_6 Say1_Mug180 Esterase
Other DBs
NCBI-GeneID: 100009551
NCBI-ProteinID: NP_001076234
Ensembl: ENSOCUG00000006737
UniProt: P12337
Structure
PDB: 
1K4Y

Position
5
AA seq 565 aa
MWLCALALASLAACTAWGHPSAPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGVPFAKPPL
GSLRFAPPQPAESWSHVKNTTSYPPMCSQDAVSGHMLSELFTNRKENIPLKFSEDCLYLN
IYTPADLTKRGRLPVMVWIHGGGLMVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIANFGGDPGSVTIFGESAGGQSVSILLLSPLTKNLF
HRAISESGVALLSSLFRKNTKSLAEKIAIEAGCKTTTSAVMVHCLRQKTEEELMEVTLKM
KFMALDLVGDPKENTAFLTTVIDGVLLPKAPAEILAEKKYNMLPYMVGINQQEFGWIIPM
QMLGYPLSEGKLDQKTATELLWKSYPIVNVSKELTPVATEKYLGGTDDPVKKKDLFLDML
ADLLFGVPSVNVARHHRDAGAPTYMYEYRYRPSFSSDMRPKTVIGDHGDEIFSVLGAPFL
KEGATEEEIKLSKMVMKYWANFARNGNPNGEGLPQWPAYDYKEGYLQIGATTQAAQKLKD
KEVAFWTELWAKEAARPRETEHIEL
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgtggctctgtgcattggccctggcctctctcgccgcttgcacggcttgggggcacccg
tctgcaccacctgtggtagatactgtgcatggcaaagtcctggggaagttcgtcagctta
gaaggatttgcacagcccgtggccgtcttcctgggagtccccttcgccaagccccctctt
ggatccctgaggtttgcaccaccacagcctgcagaatcatggagccacgtgaagaacacc
acctcctaccctcccatgtgctcccaggacgcagtatcagggcatatgctctcggagctc
ttcaccaacagaaaagagaacatccctcttaagttttctgaagactgcctttacctgaat
atttacacccctgctgacctgacaaagagaggcaggctgccggtgatggtgtggatccat
ggaggtggtctgatggtgggtggagcatcaacctatgatggcctggctctttctgcccat
gagaacgtggtggtggtgaccattcagtaccgcctgggcatctggggattcttcagcaca
ggagatgagcacagccgagggaactggggtcacttggaccaggtggctgcgctgcggtgg
gtccaggacaacattgccaactttggaggggacccaggctctgtgaccatctttggagag
tcagcaggaggtcaaagtgtctctatccttctattatcccccctgaccaagaatctcttc
catcgagcaatttccgagagtggcgtggccctcctttccagtctcttcaggaagaacacc
aagtccttggctgagaaaattgccatcgaagctgggtgtaaaaccaccacctcggctgtc
atggttcactgcctgcgccagaagacagaggaagaactcatggaggtgacattgaaaatg
aaatttatggctctagatctagttggcgaccccaaagagaacaccgccttcctgaccact
gtgattgatggggtgctgctgccaaaagcacctgcagagattctggcagagaagaaatac
aacatgctgccctacatggtgggaatcaaccagcaagagtttggctggattatcccaatg
caaatgctgggctatccactctctgaaggcaaactggaccagaagacagctacagaactc
ttgtggaagtcctaccccattgtcaatgtctctaaggagctgactccagtggccactgag
aagtatttaggagggacagatgaccctgtcaaaaagaaagacttgttcctggacatgctt
gcagatttgttatttggtgtcccatctgtgaatgtggctcgtcaccacagagatgctgga
gcccccacctatatgtatgagtatcggtatcgcccaagcttctcatcagacatgagaccc
aagacagtgataggggaccatggagatgagatcttctctgtcttaggagccccgttttta
aaagagggtgccacagaagaggagatcaaactgagcaagatggtgatgaaatactgggcc
aactttgctaggaatgggaatcccaatggagaagggcttcctcaatggccagcatatgac
tacaaggaaggttacctgcagattggagccaccacccaggcagcccagaaactgaaagac
aaggaagtggctttctggactgagctctgggccaaggaggcagcaaggccacgtgagaca
gagcacattgagctgtga

DBGET integrated database retrieval system