KEGG   Oryctolagus cuniculus (rabbit): 100009559
Entry
100009559         CDS       T03373                                 

Gene name
MMP12
Definition
(RefSeq) matrix metallopeptidase 12
  KO
K01413  matrix metalloproteinase-12 (macrophage elastase) [EC:3.4.24.65]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100009559 (MMP12)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.65  macrophage elastase
     100009559 (MMP12)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M10
   100009559 (MMP12)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 Metallopep DUF4953 Peptidase_M66 Peptidase_M54 Reprolysin_5
Other DBs
NCBI-GeneID: 100009559
NCBI-ProteinID: NP_001076240
Ensembl: ENSOCUG00000008303
UniProt: P79227
Position
1
AA seq 464 aa
MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQ
EMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDM
KREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAF
GPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDL
NTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSF
FWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYP
KSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGI
GPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaagtttcttctattgatactgaccctgtgggtcacttcttctggagctgatcctctg
aaggaaaacgatatgctatttgctgaaaactacttggaaaacttttatggccttaaggtg
gagagaattccaatgacaaaaatgaaaactaacaggaacttcatagaggaaaaagtccag
gaaatgcagcaattcttggggctaaatgtgactgggcaactggacacatctactttggaa
atgatgcacaagcctcgatgtggagtgcctgatgtttatcatttcaaaaccatgccaggg
agaccagtatggaggaaacattacatcacctacagaatcaaaaattacactccagacatg
aagcgtgaggatgttgagtatgccattcagaaagcttttcaagtatggagcgatgtgacc
cccctgaaattcagaaagattacgacaggcaaggctgacatcatgatactttttgctagt
ggagctcatggagactatggtgcttttgatggcagaggtggtgtcatagcccatgctttt
gggcctggacctggtattggaggagatacacattttgatgaggatgaaatctggagtaaa
agttataaaggcacaaacttgttccttgttgctgtccatgagcttggccatgccttggga
cttgatcattcaaatgatccaaaggccataatgtttcccacctatggttatattgatctc
aacacatttcacctctctgctgatgacatacgtggcattcagtccctttatggaggccca
gagcagcatcaacccatgccaaaacctgacaatccggaaccaactgcctgtgaccacaat
ttgaaatttgatgcagttactacagtgggaaataaaatatttttctttaaagacagcttt
ttctggtggaagattcctaagagttcaacgaccagtgtccgtttaatttcttccttatgg
ccaaccttgccttcaggcattgaggctgcttatgaaattggagacagacatcaagtattc
ctttttaaaggtgacaagttctggttaattagccatctaagactacaaccaaactatccc
aagagcatacattccctgggcttccctgactttgtgaaaaaaattgatgcagctgtcttt
aaccccagtctccggaagacctacttctttgtggataatctgtactggagatacgatgaa
aggagagaggtcatggatgctggttatcccaagctgatcaccaagcacttcccaggaatt
gggccgaaaattgacgcagtcttctatttccaaagatactactatttcttccagggacct
aaccaacttgaatatgacacattttccagtcgtgtcaccaagaagctgaaaagcaatagc
tggtttgattgctag

DBGET integrated database retrieval system