KEGG   Oryctolagus cuniculus (rabbit): 100038310
Entry
100038310         CDS       T03373                                 

Gene name
UGT1-4, UDPGT, UDPGT_1-4, UGT1, UGT1-04, UGT1.4, UGT1A4
Definition
(RefSeq) UDP-glucuronosyltransferase 1-4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00040  Pentose and glucuronate interconversions
ocu00053  Ascorbate and aldarate metabolism
ocu00140  Steroid hormone biosynthesis
ocu00830  Retinol metabolism
ocu00860  Porphyrin and chlorophyll metabolism
ocu00980  Metabolism of xenobiotics by cytochrome P450
ocu00982  Drug metabolism - cytochrome P450
ocu00983  Drug metabolism - other enzymes
ocu01100  Metabolic pathways
ocu01240  Biosynthesis of cofactors
ocu04976  Bile secretion
ocu05204  Chemical carcinogenesis
Module
ocu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100038310 (UGT1-4)
   00053 Ascorbate and aldarate metabolism
    100038310 (UGT1-4)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100038310 (UGT1-4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100038310 (UGT1-4)
   00860 Porphyrin and chlorophyll metabolism
    100038310 (UGT1-4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100038310 (UGT1-4)
   00982 Drug metabolism - cytochrome P450
    100038310 (UGT1-4)
   00983 Drug metabolism - other enzymes
    100038310 (UGT1-4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100038310 (UGT1-4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100038310 (UGT1-4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ocu01003]
    100038310 (UGT1-4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100038310 (UGT1-4)
Glycosyltransferases [BR:ocu01003]
 Others
  Hydrophobic molecule
   100038310 (UGT1-4)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 100038310
NCBI-ProteinID: NP_001082791
UniProt: Q28612
Position
Un
AA seq 532 aa
MVLGVWITLWRLVRLLLLLCVLPWAEGGKVLVVPMDGSPWLSLREVVRDVHARGHQVLVL
GPEVTMHIKGEDFFTLQTYATPYSKEEFDQLMQRNYQMIFKPQHSLKTLLETMENLKKFS
MLCSRSCWELLHNKPLIKHLNESSFDVVLTDPLDLCGALLAKYLSVPSVFLLRFILCDLD
FEGTQCPNPSSYIPRMLTMNSDHMSFLQRVKNMLYPLMMKYTCHISYDPYASLASELFQR
EVSLVDILSHASVWLFREDFVLDYPRPIMPNMVFIGGINCANRKPLSQEFEAYVNASGEH
GIVVFSLGSMVSEIPEKKAMEIADALGKIPQTVLWRYTGSRPSNLAKNTYLVKWLPQNVL
LGHPKTRAFITHSGSHGIYEGICNGVPMVMLPLFGDQMDNAKRIETRGAGVTLNVLEMTS
DDLANALKTVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAAPRPAAHDL
TWYQYHSLDVIGFLLAIVLTVAFVTFKCCAFAWGKCFGKKGRVKKAHKSKVH
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggtgctgggagtgtggatcaccctgtggcgactggtgaggctgctgctcttgctctgt
gtgctgccctgggctgagggtggcaaggtgctggtggtgcccatggatggaagcccttgg
ctcagcctgcgggaggttgtgcgggacgtccacgcccgaggccaccaagtcctggtccta
ggtcccgaggtgaccatgcacatcaaaggagaggactttttcaccctgcaaacctacgcc
accccttacagcaaggaagaatttgaccagctgatgcagcgcaactatcaaatgatcttt
aaaccacaacattctctgaagacacttttggaaactatggaaaacctcaaaaaattttcg
atgctgtgcagtaggtcttgctgggagctactgcacaacaaacccttgatcaagcacttg
aatgagagttccttcgatgtggtcttaactgacccgcttgacctctgtggtgcactgctg
gctaagtacctgtcggttccttctgtgtttttgctgcgttttatcctatgtgaccttgac
tttgagggcacacagtgcccaaacccttcctcatatattcctaggatgctaacaatgaat
tcagaccacatgagcttcctgcaaagggtcaagaacatgctctaccctctgatgatgaag
tacacttgccacatttcttatgatccgtatgcgagcctggcgtctgagctttttcagaga
gaggtgtcgttggtggatattctcagccatgcgtccgtgtggctgttccgagaagacttt
gtgctggactaccccaggcccatcatgcccaacatggtgtttattgggggcatcaactgt
gccaataggaagcctctatctcaggaatttgaagcctacgtcaatgcttccggagaacat
ggaattgtggttttctccctggggtccatggtgtctgagattccggagaagaaagctatg
gaaattgcagacgctttgggcaaaatacctcaaacggtcttgtggcggtacaccggaagt
cggccatcgaatcttgccaagaacacgtaccttgtcaagtggctaccccaaaacgtactg
ctcggtcacccgaagacgcgtgccttcatcacgcactccggctcccacggtatttatgaa
ggaatatgcaacggtgtccccatggtgatgctgcccttgtttggcgaccagatggacaac
gcgaagcgcatagagacccgtggggctggagtgaccctgaacgtccttgaaatgacctct
gatgacctagcgaatgccctaaaaacagtcatcaatgacaaaagttacaaggaaaacatc
atgcgcctctccagcctgcacaaggaccgccctgtggagccgctggacctggccgtgttc
tgggtggagttcgtgatgaggcacaagggggcggcacctcggccagccgcccacgacctc
acctggtaccagtaccactccctggacgtgatcggcttcctcctggccatcgtgctgacc
gtggccttcgtcacctttaagtgctgtgcctttgcctgggggaagtgctttgggaagaag
gggcgggtgaagaaagcacacaagtccaaggtgcactga

DBGET integrated database retrieval system